Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11140
Gene name	Cell division cycle 37, HSP90 cochaperone
Gene symbol	CDC37
Synonyms (NCBI Gene)	P50CDC37
Chromosome	19
Chromosome location	19p13.2
Summary	The protein encoded by this gene is highly similar to Cdc 37, a cell division cycle control protein of Sacchromyces cerevisiae. This protein is a molecular chaperone with specific function in cell signal transduction. It has been shown to form complex wit

Show/Hide all (85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016144	hsa-miR-615-3p	Sequencing	20371350
MIRT016565	hsa-miR-193b-3p	Proteomics	21512034
MIRT025907	hsa-miR-7-5p	Microarray	19073608
MIRT031991	hsa-miR-16-5p	Sequencing	20371350
MIRT049255	hsa-miR-92a-3p	CLASH	23622248
MIRT039401	hsa-miR-421	CLASH	23622248
MIRT052815	hsa-miR-3200-3p	CLASH	23622248
MIRT440973	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT440973	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT877384	hsa-miR-1205	CLIP-seq
MIRT877385	hsa-miR-1271	CLIP-seq
MIRT877386	hsa-miR-1273f	CLIP-seq
MIRT877387	hsa-miR-155	CLIP-seq
MIRT877388	hsa-miR-182	CLIP-seq
MIRT877389	hsa-miR-185	CLIP-seq
MIRT877390	hsa-miR-2682	CLIP-seq
MIRT877391	hsa-miR-296-5p	CLIP-seq
MIRT877392	hsa-miR-3125	CLIP-seq
MIRT877393	hsa-miR-34a	CLIP-seq
MIRT877394	hsa-miR-34c-5p	CLIP-seq
MIRT877395	hsa-miR-361-3p	CLIP-seq
MIRT877396	hsa-miR-3916	CLIP-seq
MIRT877397	hsa-miR-4433	CLIP-seq
MIRT877398	hsa-miR-4459	CLIP-seq
MIRT877399	hsa-miR-449a	CLIP-seq
MIRT877400	hsa-miR-449b	CLIP-seq
MIRT877401	hsa-miR-449c	CLIP-seq
MIRT877402	hsa-miR-4514	CLIP-seq
MIRT877403	hsa-miR-4642	CLIP-seq
MIRT877404	hsa-miR-4649-5p	CLIP-seq
MIRT877405	hsa-miR-4692	CLIP-seq
MIRT877406	hsa-miR-4728-3p	CLIP-seq
MIRT877407	hsa-miR-4762-3p	CLIP-seq
MIRT877408	hsa-miR-4766-5p	CLIP-seq
MIRT877409	hsa-miR-4767	CLIP-seq
MIRT877410	hsa-miR-4768-3p	CLIP-seq
MIRT877411	hsa-miR-4780	CLIP-seq
MIRT877412	hsa-miR-4786-3p	CLIP-seq
MIRT877413	hsa-miR-503	CLIP-seq
MIRT877414	hsa-miR-877	CLIP-seq
MIRT877415	hsa-miR-888	CLIP-seq
MIRT877416	hsa-miR-96	CLIP-seq
MIRT877385	hsa-miR-1271	CLIP-seq
MIRT877388	hsa-miR-182	CLIP-seq
MIRT1960038	hsa-miR-1913	CLIP-seq
MIRT1960039	hsa-miR-324-3p	CLIP-seq
MIRT1960040	hsa-miR-4299	CLIP-seq
MIRT877403	hsa-miR-4642	CLIP-seq
MIRT1960041	hsa-miR-4707-5p	CLIP-seq
MIRT1960042	hsa-miR-938	CLIP-seq
MIRT877416	hsa-miR-96	CLIP-seq
MIRT2196936	hsa-miR-1254	CLIP-seq
MIRT2196937	hsa-miR-1324	CLIP-seq
MIRT877389	hsa-miR-185	CLIP-seq
MIRT877390	hsa-miR-2682	CLIP-seq
MIRT2196938	hsa-miR-2861	CLIP-seq
MIRT2196939	hsa-miR-3116	CLIP-seq
MIRT877393	hsa-miR-34a	CLIP-seq
MIRT877394	hsa-miR-34c-5p	CLIP-seq
MIRT2196940	hsa-miR-3665	CLIP-seq
MIRT877399	hsa-miR-449a	CLIP-seq
MIRT877400	hsa-miR-449b	CLIP-seq
MIRT877401	hsa-miR-449c	CLIP-seq
MIRT877402	hsa-miR-4514	CLIP-seq
MIRT2196941	hsa-miR-4536	CLIP-seq
MIRT2196942	hsa-miR-4688	CLIP-seq
MIRT877405	hsa-miR-4692	CLIP-seq
MIRT877407	hsa-miR-4762-3p	CLIP-seq
MIRT877408	hsa-miR-4766-5p	CLIP-seq
MIRT877411	hsa-miR-4780	CLIP-seq
MIRT877412	hsa-miR-4786-3p	CLIP-seq
MIRT2196943	hsa-miR-570	CLIP-seq
MIRT2196944	hsa-miR-671-5p	CLIP-seq
MIRT877415	hsa-miR-888	CLIP-seq
MIRT2196945	hsa-miR-922	CLIP-seq
MIRT877389	hsa-miR-185	CLIP-seq
MIRT2196942	hsa-miR-4688	CLIP-seq
MIRT877407	hsa-miR-4762-3p	CLIP-seq
MIRT877408	hsa-miR-4766-5p	CLIP-seq
MIRT877415	hsa-miR-888	CLIP-seq
MIRT877389	hsa-miR-185	CLIP-seq
MIRT2196942	hsa-miR-4688	CLIP-seq
MIRT877407	hsa-miR-4762-3p	CLIP-seq
MIRT877408	hsa-miR-4766-5p	CLIP-seq
MIRT877415	hsa-miR-888	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	8666233
GO:0005515	Function	Protein binding	IPI	9150368, 11036079, 12176997, 14676191, 14743216, 16321986, 17979178, 19026643, 19875381, 20562859, 20642453, 21163940, 21360678, 21871133, 21900206, 21903422, 22612223, 22939624, 23075850, 23428871, 23455922, 24189400, 24366813, 24618592, 24880080, 24981860, 25036637, 25486457, 2649
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006457	Process	Protein folding	IBA
GO:0006605	Process	Protein targeting	TAS	8666233
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0019887	Function	Protein kinase regulator activity	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0019900	Function	Kinase binding	IPI	21855797
GO:0019901	Function	Protein kinase binding	IEA
GO:0031072	Function	Heat shock protein binding	IBA
GO:0031072	Function	Heat shock protein binding	IPI	9660753
GO:0050821	Process	Protein stabilization	IBA
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	TAS	8666233
GO:0051087	Function	Protein-folding chaperone binding	IBA
GO:0051879	Function	Hsp90 protein binding	IEA
GO:0060334	Process	Regulation of type II interferon-mediated signaling pathway	IMP	16280321
GO:0060338	Process	Regulation of type I interferon-mediated signaling pathway	IMP	16280321
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0097110	Function	Scaffold protein binding	IPI	10409742
GO:0101031	Component	Protein folding chaperone complex	IDA	29127155
GO:1905091	Process	Positive regulation of type 2 mitophagy	IEA
GO:1990565	Component	HSP90-CDC37 chaperone complex	IDA	21855797
GO:1990565	Component	HSP90-CDC37 chaperone complex	IEA

MIM	HGNC	e!Ensembl
605065	1735	ENSG00000105401

Q16543

Protein name

Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed]

Protein function

Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity (PubMed:8666233). Inhibits HSP90AA1 ATPase activity (PubMed:23569206). {ECO:0000269|Pub

PDB

1US7 , 2K5B , 2N5X , 2NCA , 2W0G , 5FWK , 5FWL , 5FWM , 5FWP , 5HPE , 7Z37 , 7Z38 , 7ZR0 , 7ZR5 , 7ZR6 , 8GAE , 8GFT , 8U1L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03234	CDC37_N	1 → 164	Cdc37 N terminal kinase binding	Domain
PF08565	CDC37_M	161 → 276	Cdc37 Hsp90 binding domain	Domain
PF08564	CDC37_C	286 → 360	Cdc37 C terminal domain	Domain

Sequence

MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS
KDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH
LVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK
IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYES
LPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG
DPLLEAVPKTGDEKDVSV

Sequence length

378

Interactions

View interactions

	KEGG		Reactome
	PI3K-Akt signaling pathway		Signaling by ERBB2 Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants Constitutive Signaling by EGFRvIII Downregulation of ERBB2 signaling Constitutive Signaling by Overexpressed ERBB2 Drug-mediated inhibition of ERBB2 signaling Signaling by ERBB2 KD Mutants Resistance of ERBB2 KD mutants to trastuzumab Resistance of ERBB2 KD mutants to sapitinib Resistance of ERBB2 KD mutants to tesevatinib Resistance of ERBB2 KD mutants to neratinib Resistance of ERBB2 KD mutants to osimertinib Resistance of ERBB2 KD mutants to afatinib Resistance of ERBB2 KD mutants to AEE788 Resistance of ERBB2 KD mutants to lapatinib Signaling by ERBB2 ECD mutants Signaling by ERBB2 TMD/JMD mutants Drug resistance in ERBB2 TMD/JMD mutants

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	23749187		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10822368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22912728, 24869908, 24927996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22912728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34884975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15289859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29288563, 31555737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18931700, 24292678, 27391062, 38359495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26192919, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	23584476, 31776458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	31776458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	GWASDB_DG	22968135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38359495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233, 26192919, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16216419, 16317707, 25098386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10822368, 12907640, 31181782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15661534, 18089825, 18931700, 19082487, 19177013, 28482218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27391062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15289859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21871133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37409850	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	21833088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	21833088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	36571271	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	14668798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31824256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	14668798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10822368, 12907640, 31181782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	10822368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18089825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29288563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37413850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30039622		★★★★★ ★☆☆☆☆ Found in Text Mining only

CDC37 (cell division cycle 37, HSP90 cochaperone)