Gene Gene information from NCBI Gene database.
Entrez ID 11135
Gene name CDC42 effector protein 1
Gene symbol CDC42EP1
Synonyms (NCBI Gene)
BORG5CEP1MSE55
Chromosome 22
Chromosome location 22q13.1
Summary CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. Thi
miRNA miRNA information provided by mirtarbase database.
179
miRTarBase ID miRNA Experiments Reference
MIRT043823 hsa-miR-328-3p CLASH 23622248
MIRT039933 hsa-miR-615-3p CLASH 23622248
MIRT039539 hsa-miR-652-3p CLASH 23622248
MIRT037123 hsa-miR-877-3p CLASH 23622248
MIRT036551 hsa-miR-1224-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 20936779, 21988832, 25416956, 31980649, 32296183, 35271311
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0005856 Component Cytoskeleton IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606084 17014 ENSG00000128283
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q00587
Protein name Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum protein MSE55)
Protein function Probably involved in the organization of the actin cytoskeleton. Induced membrane extensions in fibroblasts.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00786 PBD 37 67 P21-Rho-binding domain Domain
PF14957 BORG_CEP 162 217 Cdc42 effector Family
Tissue specificity TISSUE SPECIFICITY: Endothelial and bone marrow stromal cells.
Sequence
MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGD
TSFLSNH
GGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAI
SLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGS
FPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLP
EAPAAETPAPAANPPAPTANPTG
PAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEV
KSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRA
PQAGSRTPVPSTVQANTFEFADAEEDDEVKV
Sequence length 391
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTOIMMUNE HEPATITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sarcoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis Arthritis BEFREE 21953289
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 20192991
★☆☆☆☆
Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome 11p11.2 Deletion Syndrome BEFREE 28919520
★☆☆☆☆
Found in Text Mining only
Congenital chromosomal disease Congenital Chromosomal Disease BEFREE 18284415
★☆☆☆☆
Found in Text Mining only
Degenerative polyarthritis Arthritis BEFREE 29084415
★☆☆☆☆
Found in Text Mining only
Endometriosis Endometriosis Pubtator 37757976 Associate
★☆☆☆☆
Found in Text Mining only
Lung Diseases, Interstitial Lung Diseases BEFREE 29452423, 30611755
★☆☆☆☆
Found in Text Mining only
Milroy Disease Milroy Disease BEFREE 18284415
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 37757976 Associate
★☆☆☆☆
Found in Text Mining only
PEELING SKIN SYNDROME Peeling Skin Syndrome BEFREE 28919520
★☆☆☆☆
Found in Text Mining only