CHGA (chromogranin A)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 1113
Gene name Chromogranin A
Gene symbol CHGA
Synonyms (NCBI Gene)
CGAPHE5PHES
Chromosome 14
Chromosome location 14q32.12
Summary The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active pep
miRNA miRNA information provided by mirtarbase database.
9
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (9)
miRTarBase ID miRNA Experiments Reference
MIRT732556 hsa-miR-375 RNA-seq 33037409
MIRT889845 hsa-miR-4773 CLIP-seq
MIRT2200023 hsa-miR-197 CLIP-seq
MIRT2200024 hsa-miR-3974 CLIP-seq
MIRT2200025 hsa-miR-4670-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
5
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (5)
Transcription factor Regulation Reference
CTNNB1 Unknown 21551321
EGR1 Activation 12456801
LEF1 Unknown 21551321
REST Unknown 19118055
SP1 Unknown 1819225
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (35)
GO ID Ontology Definition Evidence Reference
GO:0002026 Process Regulation of the force of heart contraction ISS
GO:0002551 Process Mast cell chemotaxis IDA 21214543
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
118910 1929 ENSG00000100604
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P10645
Protein name Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) [Cleaved into: Vasostatin-1 (Vasostatin I); Vasostatin-2 (Vasostatin II); EA-92; ES-43; Pancreastatin; SS-18; WA-8; WE-14; LF-19; Catestatin (SL21); AL-11; GV-19; GR-44; ER-37; GE-25; Serpinin-RR
Protein function [Pancreastatin]: Strongly inhibits glucose induced insulin release from the pancreas.; [Catestatin]: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic an
PDB 1LV4 , 6R2X
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01271 Granin 25 → 93 Granin (chromogranin or secretogranin) Family
PF01271 Granin 85 → 457 Granin (chromogranin or secretogranin) Family
Tissue specificity TISSUE SPECIFICITY: Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Detected in urine (at protein level) (PubMed:37453717). {ECO:0000269|PubMed:25326458, ECO:0000269|PubMed:37453717}.; TISSUE SPECIFICITY: [GE-25]: Found in the brain.
Sequence 
MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETL
RGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEA
VEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEA
TNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAG
EEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHS
QQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEG
QEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE
EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
Sequence length 457
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Antimicrobial peptides
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (7)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, BASAL CELL — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (323)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
3 beta-Hydroxysteroid dehydrogenase deficiency 3 beta-hydroxysteroid dehydrogenase deficiency BEFREE 8284113
★★★★★
★☆☆☆☆
Found in Text Mining only
Activated Protein C Resistance Activated Protein C Resistance BEFREE 9170375
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome BEFREE 24325234, 27681934
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 9002938
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 11830555, 14533935, 14734658, 15016319, 17929277, 26482608, 30337589, 30458812, 30914778, 31653712, 31786484, 9465942
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 15462496, 17929277
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of prostate Prostate adenocarcinoma BEFREE 14968443
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 1923947, 2118538, 8162254
★★★★★
★☆☆☆☆
Found in Text Mining only
Adrenal Cortical Adenoma Adrenocortical adenoma LHGDN 15648545
★★★★★
★☆☆☆☆
Found in Text Mining only
Adrenal Gland Diseases Adrenal Gland Diseases CTD_human_DG 20146381
★★★★★
★☆☆☆☆
Found in Text Mining only