CD160 (CD160 molecule)

Gene

• Entrez ID: 11126
• Gene name: CD160 molecule
• Gene symbol: CD160
• Synonyms (NCBI Gene): BY55, NK1, NK28
• Chromosome: 1
• Chromosome location: 1q21.1
• Summary: CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predic

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018975	hsa-miR-335-5p	Microarray	18185580
MIRT732966	hsa-miR-1236-3p	qRT-PCR	33788641
MIRT873735	hsa-miR-361-3p	CLIP-seq
MIRT873736	hsa-miR-3679-3p	CLIP-seq
MIRT873737	hsa-miR-3938	CLIP-seq
MIRT873738	hsa-miR-4282	CLIP-seq
MIRT2196124	hsa-miR-561	CLIP-seq
MIRT2499224	hsa-miR-3945	CLIP-seq
MIRT2499225	hsa-miR-4253	CLIP-seq
MIRT2499226	hsa-miR-4311	CLIP-seq
MIRT2499227	hsa-miR-4729	CLIP-seq
MIRT2499228	hsa-miR-539	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002385	Process	Mucosal immune response	IEA
GO:0002717	Process	Positive regulation of natural killer cell mediated immunity	IEA
GO:0002729	Process	Positive regulation of natural killer cell cytokine production	IDA	17307798
GO:0002819	Process	Regulation of adaptive immune response	IEA
GO:0002857	Process	Positive regulation of natural killer cell mediated immune response to tumor cell	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005102	Function	Signaling receptor binding	IDA	9973372
GO:0005515	Function	Protein binding	IPI	11978774, 16809620, 18193050, 25416956, 27152329, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9973372, 11978774, 18193050, 19109136
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	16809620
GO:0019900	Function	Kinase binding	IPI	11978774
GO:0023024	Function	MHC class I protein complex binding	IEA
GO:0031295	Process	T cell costimulation	IDA	9973372, 11978774
GO:0032393	Function	MHC class I receptor activity	IDA	15494480
GO:0032394	Function	MHC class Ib receptor activity	IDA	16809620
GO:0032397	Function	Activating MHC class I receptor activity	IDA	9973372, 11978774, 12486241
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0043323	Process	Positive regulation of natural killer cell degranulation	IDA	19109136
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	17307798
GO:0045087	Process	Innate immune response	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	12486241, 17307798
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	18193050
GO:0098552	Component	Side of membrane	IEA
GO:1900280	Process	Negative regulation of CD4-positive, alpha-beta T cell costimulation	IDA	18193050
GO:1905675	Process	Negative regulation of adaptive immune memory response	IDA	18193050
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	16809620

Other IDs

• MIM: 604463
• HGNC: 17013
• e!Ensembl: ENSG00000117281

Protein

• UniProt ID: O95971
• Protein name: CD160 antigen (Natural killer cell receptor BY55) (CD antigen CD160) [Cleaved into: CD160 antigen, soluble form]
• Protein function: [CD160 antigen]: Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pat
• PDB: 6NG3, 6NG9, 6NGG, 7MSG
• Tissue specificity: TISSUE SPECIFICITY: Expression is restricted to functional NK and cytotoxic T lymphocytes. Expressed in viral-specific effector memory and terminally differentiated effector memory CD8+ T cells. Expressed in memory and activated CD4+ T cell subsets (at pr
• Sequence:

  MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFL
  CKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG
  IRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQA
  L

• Sequence length: 181

Pathways

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21120581		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21120581		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	15845098		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	15845098		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19234211		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22449398	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19803739		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15913794		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26071079	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19234211, 30842773		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30842773, 34238277	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25175857		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	37996402	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21120581		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21715317, 25470765, 25615279		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31191543	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21482699		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29843798		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32393998	Stimulate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	29860455		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23454163, 31191543		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31191543	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	9572640		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15845098, 28753469		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	23064081	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	17218942		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	35222360	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	31541747		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27577071		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27577071		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27577071	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	33788641	Associate	★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	28814387		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30301182		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30301182		★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	BEFREE	30842773		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	30842773, 34238277	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	21715317		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	10910932		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	25883386		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19803739		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	17218942		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	21715317	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33239726	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30232222		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37014183	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28753469		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25175857		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27577071		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30232222		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21034671, 21715317		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	21715317		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24548567, 27458061		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35428910	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15845098, 28753469		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27621226		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	27458061		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	23064081	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	25044837	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36438903	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1790142, 21482699, 25470765, 27458061, 29843798		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32055919	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	22172098		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	26619809		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36124532	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10189055, 22449398, 9572640		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16815618		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17218942		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	17667845		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	38538269	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39244216	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	34238277	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21342363, 31191543		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	28753469		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34858395	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	24548567		★☆☆☆☆ Found in Text Mining only