CHEK1 (checkpoint kinase 1)

Gene

• Entrez ID: 1111
• Gene name: Checkpoint kinase 1
• Gene symbol: CHEK1
• Synonyms (NCBI Gene): CHK1, OZEMA21
• Chromosome: 11
• Chromosome location: 11q24.2
• Summary: The protein encoded by this gene belongs to the Ser/Thr protein kinase family. It is required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. This protein acts to integrate signals from ATM and ATR,

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs772079899	C>G,T	Pathogenic	Stop gained, coding sequence variant, non coding transcript variant, missense variant
rs1314180672	A>G,T	Likely-pathogenic	Splice acceptor variant, intron variant
rs1565374246	CC>-	Pathogenic	Coding sequence variant, non coding transcript variant, stop gained

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000656	hsa-miR-424-5p	Luciferase reporter assay	19956200
MIRT000647	hsa-miR-503-5p	Luciferase reporter assay	19956200
MIRT016503	hsa-miR-193b-3p	Microarray	20304954
MIRT030555	hsa-miR-24-3p	Reporter assay;Western blot;qRT-PCR;Other	19748357
MIRT049764	hsa-miR-92a-3p	CLASH	23622248
MIRT046455	hsa-miR-15b-5p	CLASH	23622248
MIRT044177	hsa-miR-99b-5p	CLASH	23622248
MIRT000656	hsa-miR-424-5p	Luciferase reporter assay, Western blot	22469983
MIRT000656	hsa-miR-424-5p	Luciferase reporter assay, Western blot	22469983
MIRT054859	hsa-miR-497-5p	and 293T cell"	24464213
MIRT265077	hsa-miR-16-5p	Luciferase reporter assay, Western blot	24336073
MIRT438209	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	24336073
MIRT265077	hsa-miR-16-5p	Luciferase reporter assay, Western blot	24336073
MIRT438209	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	24336073
MIRT265087	hsa-miR-6838-5p	HITS-CLIP	23313552
MIRT000656	hsa-miR-424-5p	HITS-CLIP	23313552
MIRT265078	hsa-miR-195-5p	HITS-CLIP	23313552
MIRT046455	hsa-miR-15b-5p	HITS-CLIP	23313552
MIRT265077	hsa-miR-16-5p	HITS-CLIP	23313552
MIRT265076	hsa-miR-15a-5p	HITS-CLIP	23313552
MIRT054859	hsa-miR-497-5p	HITS-CLIP	23313552
MIRT000647	hsa-miR-503-5p	HITS-CLIP	23313552
MIRT704711	hsa-miR-505-3p	HITS-CLIP	23313552
MIRT704710	hsa-miR-6507-5p	HITS-CLIP	23313552
MIRT331938	hsa-miR-513b-3p	HITS-CLIP	23313552
MIRT704709	hsa-miR-646	HITS-CLIP	23313552
MIRT265086	hsa-miR-6074	HITS-CLIP	23313552
MIRT704708	hsa-miR-1226-3p	HITS-CLIP	23313552
MIRT265084	hsa-miR-4733-3p	HITS-CLIP	23313552
MIRT265079	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT265083	hsa-miR-4524a-5p	HITS-CLIP	23313552
MIRT265085	hsa-miR-4524b-5p	HITS-CLIP	23313552
MIRT704707	hsa-miR-197-3p	HITS-CLIP	23313552
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT129466	hsa-miR-3941	HITS-CLIP	23313552
MIRT129470	hsa-miR-4672	HITS-CLIP	23313552
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT674107	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT674107	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT129473	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT403557	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT669040	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT669039	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT669038	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT669037	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT669036	hsa-miR-4252	HITS-CLIP	23824327
MIRT669035	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT669034	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT669033	hsa-miR-7703	HITS-CLIP	23824327
MIRT669032	hsa-miR-4531	HITS-CLIP	23824327
MIRT669031	hsa-miR-1270	HITS-CLIP	23824327
MIRT669030	hsa-miR-620	HITS-CLIP	23824327
MIRT669029	hsa-miR-550b-2-5p	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT403557	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT129473	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT129473	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT403557	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT129473	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	24906430
MIRT607512	hsa-miR-4801	HITS-CLIP	24906430
MIRT607511	hsa-miR-8485	HITS-CLIP	24906430
MIRT265076	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT046455	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT265077	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT265078	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT129454	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT129455	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT265078	hsa-miR-195-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26867682
MIRT265078	hsa-miR-195-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26867682
MIRT000647	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26867682
MIRT000647	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26867682
MIRT265076	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25594541
MIRT046455	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25594541
MIRT265077	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	25594541
MIRT265078	hsa-miR-195-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25840419
MIRT609402	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT609401	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT129466	hsa-miR-3941	HITS-CLIP	27418678
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	27418678
MIRT607512	hsa-miR-4801	HITS-CLIP	27418678
MIRT609400	hsa-miR-603	HITS-CLIP	27418678
MIRT607511	hsa-miR-8485	HITS-CLIP	27418678
MIRT265087	hsa-miR-6838-5p	HITS-CLIP	23313552
MIRT000656	hsa-miR-424-5p	HITS-CLIP	23313552
MIRT265078	hsa-miR-195-5p	HITS-CLIP	23313552
MIRT046455	hsa-miR-15b-5p	HITS-CLIP	23313552
MIRT265077	hsa-miR-16-5p	HITS-CLIP	23313552
MIRT265076	hsa-miR-15a-5p	HITS-CLIP	23313552
MIRT054859	hsa-miR-497-5p	HITS-CLIP	23313552
MIRT000647	hsa-miR-503-5p	HITS-CLIP	23313552
MIRT704711	hsa-miR-505-3p	HITS-CLIP	23313552
MIRT704710	hsa-miR-6507-5p	HITS-CLIP	23313552
MIRT331938	hsa-miR-513b-3p	HITS-CLIP	23313552
MIRT704709	hsa-miR-646	HITS-CLIP	23313552
MIRT265086	hsa-miR-6074	HITS-CLIP	23313552
MIRT704708	hsa-miR-1226-3p	HITS-CLIP	23313552
MIRT265084	hsa-miR-4733-3p	HITS-CLIP	23313552
MIRT265079	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT265083	hsa-miR-4524a-5p	HITS-CLIP	23313552
MIRT265085	hsa-miR-4524b-5p	HITS-CLIP	23313552
MIRT704707	hsa-miR-197-3p	HITS-CLIP	23313552
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT129466	hsa-miR-3941	HITS-CLIP	23313552
MIRT129470	hsa-miR-4672	HITS-CLIP	23313552
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT674107	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT674107	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT129473	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT403557	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT669040	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT669039	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT669038	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT669037	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT669036	hsa-miR-4252	HITS-CLIP	23824327
MIRT669035	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT669034	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT669033	hsa-miR-7703	HITS-CLIP	23824327
MIRT669032	hsa-miR-4531	HITS-CLIP	23824327
MIRT669031	hsa-miR-1270	HITS-CLIP	23824327
MIRT669030	hsa-miR-620	HITS-CLIP	23824327
MIRT669029	hsa-miR-550b-2-5p	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT403557	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT129473	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT129473	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT403557	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT607513	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT607512	hsa-miR-4801	HITS-CLIP	23824327
MIRT609402	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609401	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609400	hsa-miR-603	HITS-CLIP	23824327
MIRT129466	hsa-miR-3941	HITS-CLIP	23824327
MIRT129470	hsa-miR-4672	HITS-CLIP	23824327
MIRT129464	hsa-miR-466	HITS-CLIP	23824327
MIRT607511	hsa-miR-8485	HITS-CLIP	23824327
MIRT129473	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609399	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609398	hsa-miR-6083	HITS-CLIP	23824327
MIRT889682	hsa-miR-3122	CLIP-seq
MIRT889683	hsa-miR-3165	CLIP-seq
MIRT889684	hsa-miR-320e	CLIP-seq
MIRT889685	hsa-miR-3614-5p	CLIP-seq
MIRT889686	hsa-miR-3665	CLIP-seq
MIRT889687	hsa-miR-3689a-3p	CLIP-seq
MIRT889688	hsa-miR-3689c	CLIP-seq
MIRT889689	hsa-miR-3714	CLIP-seq
MIRT889690	hsa-miR-3913-5p	CLIP-seq
MIRT889691	hsa-miR-4668-3p	CLIP-seq
MIRT889692	hsa-miR-4728-5p	CLIP-seq
MIRT889693	hsa-miR-4736	CLIP-seq
MIRT889694	hsa-miR-605	CLIP-seq
MIRT889695	hsa-miR-940	CLIP-seq
MIRT889696	hsa-miR-1226	CLIP-seq
MIRT889697	hsa-miR-1251	CLIP-seq
MIRT889698	hsa-miR-1286	CLIP-seq
MIRT889699	hsa-miR-15a	CLIP-seq
MIRT889700	hsa-miR-15b	CLIP-seq
MIRT889701	hsa-miR-16	CLIP-seq
MIRT889702	hsa-miR-195	CLIP-seq
MIRT889703	hsa-miR-197	CLIP-seq
MIRT889704	hsa-miR-3185	CLIP-seq
MIRT889705	hsa-miR-331-3p	CLIP-seq
MIRT889706	hsa-miR-424	CLIP-seq
MIRT889707	hsa-miR-4436a	CLIP-seq
MIRT889708	hsa-miR-4476	CLIP-seq
MIRT889709	hsa-miR-4524	CLIP-seq
MIRT889710	hsa-miR-4643	CLIP-seq
MIRT889711	hsa-miR-4684-5p	CLIP-seq
MIRT889712	hsa-miR-4722-5p	CLIP-seq
MIRT889713	hsa-miR-4738-3p	CLIP-seq
MIRT889714	hsa-miR-497	CLIP-seq
MIRT889715	hsa-miR-503	CLIP-seq
MIRT889716	hsa-miR-505	CLIP-seq
MIRT889717	hsa-miR-606	CLIP-seq
MIRT889718	hsa-miR-873	CLIP-seq
MIRT889719	hsa-miR-942	CLIP-seq
MIRT889699	hsa-miR-15a	CLIP-seq
MIRT889700	hsa-miR-15b	CLIP-seq
MIRT889701	hsa-miR-16	CLIP-seq
MIRT889702	hsa-miR-195	CLIP-seq
MIRT889706	hsa-miR-424	CLIP-seq
MIRT889709	hsa-miR-4524	CLIP-seq
MIRT889714	hsa-miR-497	CLIP-seq
MIRT889715	hsa-miR-503	CLIP-seq
MIRT889716	hsa-miR-505	CLIP-seq
MIRT889699	hsa-miR-15a	CLIP-seq
MIRT889700	hsa-miR-15b	CLIP-seq
MIRT889701	hsa-miR-16	CLIP-seq
MIRT889702	hsa-miR-195	CLIP-seq
MIRT889706	hsa-miR-424	CLIP-seq
MIRT889709	hsa-miR-4524	CLIP-seq
MIRT889714	hsa-miR-497	CLIP-seq
MIRT889715	hsa-miR-503	CLIP-seq
MIRT889716	hsa-miR-505	CLIP-seq
MIRT889699	hsa-miR-15a	CLIP-seq
MIRT889700	hsa-miR-15b	CLIP-seq
MIRT889701	hsa-miR-16	CLIP-seq
MIRT889702	hsa-miR-195	CLIP-seq
MIRT889706	hsa-miR-424	CLIP-seq
MIRT889709	hsa-miR-4524	CLIP-seq
MIRT889714	hsa-miR-497	CLIP-seq
MIRT889715	hsa-miR-503	CLIP-seq
MIRT889716	hsa-miR-505	CLIP-seq
MIRT889699	hsa-miR-15a	CLIP-seq
MIRT889700	hsa-miR-15b	CLIP-seq
MIRT889701	hsa-miR-16	CLIP-seq
MIRT889702	hsa-miR-195	CLIP-seq
MIRT889706	hsa-miR-424	CLIP-seq
MIRT889709	hsa-miR-4524	CLIP-seq
MIRT889714	hsa-miR-497	CLIP-seq
MIRT889715	hsa-miR-503	CLIP-seq
MIRT889716	hsa-miR-505	CLIP-seq
MIRT889696	hsa-miR-1226	CLIP-seq
MIRT889698	hsa-miR-1286	CLIP-seq
MIRT889699	hsa-miR-15a	CLIP-seq
MIRT889700	hsa-miR-15b	CLIP-seq
MIRT889701	hsa-miR-16	CLIP-seq
MIRT889702	hsa-miR-195	CLIP-seq
MIRT889703	hsa-miR-197	CLIP-seq
MIRT2199997	hsa-miR-2355-5p	CLIP-seq
MIRT889706	hsa-miR-424	CLIP-seq
MIRT889707	hsa-miR-4436a	CLIP-seq
MIRT889709	hsa-miR-4524	CLIP-seq
MIRT2199998	hsa-miR-4537	CLIP-seq
MIRT889712	hsa-miR-4722-5p	CLIP-seq
MIRT889714	hsa-miR-497	CLIP-seq
MIRT889715	hsa-miR-503	CLIP-seq
MIRT889717	hsa-miR-606	CLIP-seq
MIRT889718	hsa-miR-873	CLIP-seq
MIRT2386011	hsa-miR-1827	CLIP-seq
MIRT889682	hsa-miR-3122	CLIP-seq
MIRT889683	hsa-miR-3165	CLIP-seq
MIRT2386012	hsa-miR-3202	CLIP-seq
MIRT889685	hsa-miR-3614-5p	CLIP-seq
MIRT889686	hsa-miR-3665	CLIP-seq
MIRT889687	hsa-miR-3689a-3p	CLIP-seq
MIRT889688	hsa-miR-3689c	CLIP-seq
MIRT889689	hsa-miR-3714	CLIP-seq
MIRT889690	hsa-miR-3913-5p	CLIP-seq
MIRT2386013	hsa-miR-3929	CLIP-seq
MIRT2386014	hsa-miR-4419b	CLIP-seq
MIRT2386015	hsa-miR-4478	CLIP-seq
MIRT2386016	hsa-miR-4533	CLIP-seq
MIRT2386017	hsa-miR-4649-3p	CLIP-seq
MIRT889712	hsa-miR-4722-5p	CLIP-seq
MIRT889692	hsa-miR-4728-5p	CLIP-seq
MIRT889693	hsa-miR-4736	CLIP-seq
MIRT2386018	hsa-miR-4768-3p	CLIP-seq
MIRT2386019	hsa-miR-890	CLIP-seq
MIRT889695	hsa-miR-940	CLIP-seq
MIRT889716	hsa-miR-505	CLIP-seq
MIRT2386011	hsa-miR-1827	CLIP-seq
MIRT889712	hsa-miR-4722-5p	CLIP-seq
MIRT2386018	hsa-miR-4768-3p	CLIP-seq
MIRT2446999	hsa-miR-665	CLIP-seq
MIRT889695	hsa-miR-940	CLIP-seq
MIRT889698	hsa-miR-1286	CLIP-seq
MIRT889707	hsa-miR-4436a	CLIP-seq
MIRT889712	hsa-miR-4722-5p	CLIP-seq
MIRT889698	hsa-miR-1286	CLIP-seq
MIRT889707	hsa-miR-4436a	CLIP-seq
MIRT889712	hsa-miR-4722-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BCL6	Repression	18346918
E2F1	Unknown	18660752
MYC	Activation	23269272
TP53	Repression	15016801
TP53	Unknown	11152453

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IDA	16963448
GO:0000077	Process	DNA damage checkpoint signaling	IEA
GO:0000077	Process	DNA damage checkpoint signaling	IEA
GO:0000077	Process	DNA damage checkpoint signaling	IMP	19716789
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	2188730
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000781	Component	Chromosome, telomeric region	IDA	15149599
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISS
GO:0000794	Component	Condensed nuclear chromosome	IDA	9382850
GO:0001833	Process	Inner cell mass cell proliferation	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	22024163
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	9278511, 16963448
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	11836499, 15665856, 15798197, 16330544, 16511572, 16963448, 17380128, 19223857, 19330022, 19716789, 20639859, 22505024, 22939624, 25249323, 28514442, 33961781, 35271311, 35512704, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	HDA	23580065
GO:0005634	Component	Nucleus	IDA	15311285, 20932473, 26296656
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005657	Component	Replication fork	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	26296656
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	15311285
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006260	Process	DNA replication	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IMP	19716789
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	ISS
GO:0006468	Process	Protein phosphorylation	IDA	33108758
GO:0006915	Process	Apoptotic process	IDA	23028632
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	20932473
GO:0006974	Process	DNA damage response	ISS
GO:0006997	Process	Nucleus organization	IEA
GO:0006998	Process	Nuclear envelope organization	IDA	2188730
GO:0007077	Process	Mitotic nuclear membrane disassembly	IDA	2188730
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IBA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IMP	20932473
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010569	Process	Regulation of double-strand break repair via homologous recombination	IDA	15665856
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IDA	20360007
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	15665856
GO:0019904	Function	Protein domain specific binding	IPI	26296656
GO:0032991	Component	Protein-containing complex	IDA	26296656
GO:0035402	Function	Histone H3T11 kinase activity	IBA
GO:0035402	Function	Histone H3T11 kinase activity	IDA	18243098
GO:0035402	Function	Histone H3T11 kinase activity	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042770	Process	Signal transduction in response to DNA damage	IDA	16963448
GO:0042770	Process	Signal transduction in response to DNA damage	IEA
GO:0044818	Process	Mitotic G2/M transition checkpoint	IDA	9278511
GO:0044818	Process	Mitotic G2/M transition checkpoint	IMP	33108758
GO:0045787	Process	Positive regulation of cell cycle	IDA	26296656
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IEA
GO:0045814	Process	Negative regulation of gene expression, epigenetic	ISS
GO:0045839	Process	Negative regulation of mitotic nuclear division	IDA	15311285
GO:0046602	Process	Regulation of mitotic centrosome separation	IDA	15311285
GO:0070317	Process	Negative regulation of G0 to G1 transition	TAS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0090399	Process	Replicative senescence	NAS	15149599
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1901988	Process	Negative regulation of cell cycle phase transition	IEA
GO:1902742	Process	Apoptotic process involved in development	IEA

Other IDs

• MIM: 603078
• HGNC: 1925
• e!Ensembl: ENSG00000149554

Protein

• UniProt ID: O14757
• Protein name: Serine/threonine-protein kinase Chk1 (EC 2.7.11.1) (CHK1 checkpoint homolog) (Cell cycle checkpoint kinase) (Checkpoint kinase-1)
• Protein function: Serine/threonine-protein kinase which is required for checkpoint-mediated cell cycle arrest and activation of DNA repair in response to the presence of DNA damage or unreplicated DNA (PubMed:11535615, PubMed:12399544, PubMed:12446774, PubMed:145
• PDB: 1IA8, 1NVQ, 1NVR, 1NVS, 1ZLT, 1ZYS, 2AYP, 2BR1, 2BRB, 2BRG, 2BRH, 2BRM, 2BRN, 2BRO, 2C3J, 2C3K, 2C3L, 2CGU, 2CGV, 2CGW, 2CGX, 2E9N, 2E9O, 2E9P, 2E9U, 2E9V, 2GDO, 2GHG, 2HOG, 2HXL, 2HXQ, 2HY0, 2QHM, 2QHN, 2R0U, 2WMQ, 2WMR, 2WMS, 2WMT, 2WMU, 2WMV, 2WMW, 2WMX, 2X8D, 2X8E, 2X8I, 2XEY, 2XEZ, 2XF0, 2YDI, 2YDJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	9 → 265	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed ubiquitously with the most abundant expression in thymus, testis, small intestine and colon. {ECO:0000269|PubMed:9278511, ECO:0000269|PubMed:9382850}.
• Sequence:

  MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
  MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
  LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
  RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
  LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
  SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
  GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
  NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT

• Sequence length: 476

Pathways

KEGG:

Cell cycle
p53 signaling pathway
Cellular senescence
Human T-cell leukemia virus 1 infection
Human immunodeficiency virus 1 infection
Viral carcinogenesis

Reactome:

Signaling by SCF-KIT
Activation of ATR in response to replication stress
Processing of DNA double-strand break ends
Presynaptic phase of homologous DNA pairing and strand exchange
TP53 Regulates Transcription of DNA Repair Genes
Regulation of TP53 Activity through Phosphorylation
G2/M DNA damage checkpoint
Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
Transcriptional Regulation by E2F6

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Male infertility due to gonadal dysgenesis or sperm disorder	Likely pathogenic	rs199535573	RCV003991594	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Oocyte/zygote/embryo maturation arrest 21	Pathogenic	rs2136029824, rs2498414424, rs2498414471, rs2498413938	RCV003444093 RCV003444094 RCV003444095 RCV003444096	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHEK1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary cancer-predisposing syndrome	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY DUE TO TESTICULAR DYSGENESIS OR SPERM DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26542114, 31717700		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	19398952, 22258035		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24113549, 28754670, 29138515, 30607635, 31508486, 31528122		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	25301724		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	30413320	Associate	★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	26988986		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29753759, 31669383		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23550703	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	20052416		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	21389083	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	23454898	Inhibit	★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	Pubtator	21423868	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30538111		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	31721906	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31173250	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22532985		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	18495871	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	12576328, 18353973, 22948311, 23447702, 24142626, 28031537, 29395063, 31649026, 31708417	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	18344416, 21289283, 21927021, 23107892, 23365423, 24142626, 24804719, 25310623, 25521189, 28031537, 29242514, 29395063, 30304680, 31649026, 9926940		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27740938	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26295308, 30894677		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25349305, 26657501, 28049532		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21999571		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	14678969, 20567916		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	CLINGEN_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15710331, 15951971, 18469532, 18823530, 20567916, 21401699, 21707865, 21730979, 21803008, 23296058, 23844225, 24636978, 25460505, 25468710, 26459098, 26850987, 28513990, 29075961, 29326282, 29356917, 30607635, 30816435, 31441116, 31492187, 31601781		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25688741		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17055492, 18823530, 19716789, 21803008, 23917378, 25460505, 25468710, 25520248, 25688741, 26459098, 27167194, 29326282, 31441116, 31963582, 32210727, 33261142, 33313822, 33477536, 35186236, 35418303, 36344674, 36749285	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23825533	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	28808232	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21440578, 23533280, 29963769	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30428154	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11948492, 19453842		★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	19259937	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27350734	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27350734, 30228980, 30315225, 32596342, 33232580, 34087888, 36347033, 36403263	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25349305, 26657501, 28049532		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10987268, 21291864, 24114124, 24418519, 26438152, 29118324, 31044505		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	15488637, 28808232		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33332934, 34474677	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32349972, 37464398	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	28766886	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29118324, 29963769, 33162799, 36714024, 39694330	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21927021, 22641286, 23383610, 25474241, 28847989, 28984489		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27740938	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	22469983, 25386925, 29621769, 29805632		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21154811		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21154811, 21643982, 22469983, 25386925, 29621769, 29805632		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29753759, 31669383		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33200197	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31832331		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27556692		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	17088560		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28751935	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12071807, 19502782, 20590661, 28888100		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17879369		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19502782, 35392038	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17408908, 21807500, 24971465, 27286453, 28915668, 29082250, 29203250, 29928473, 30714316, 31173250		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17408908		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17848589, 18159231, 18632613, 24996846, 25301724, 27690730, 28389531, 28573382, 29082250, 31040255, 31173250, 32161100, 32503434, 35567913, 35881546, 36734271, 37237279, 37945594	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29870526	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	31784646, 9926940		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26474283		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36543921	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34681648	Inhibit	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31064869		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10469457, 31805725		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33754208	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25450480	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31485619, 36991467	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	30282812, 31649026		★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	BEFREE	26714930		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	LHGDN	14988723, 18029388, 18424430		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	14988723, 17296736, 21183791, 26771352	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	19371427, 21389083, 22537224, 23698467, 23779253, 23825533, 26438152, 29118324		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	19371427, 22537224, 23698467, 23779253, 23825533, 26438152, 29118324		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22313687, 22481303, 30158599, 32897363, 35806055, 38003585, 39528802	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22481303, 29287241, 29781781, 31639020		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22481303, 29287241, 29781781, 31639020		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19001440, 22313687, 23667469, 30548945	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19969004		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	30548945	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23839309, 31209198		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23839309, 29229598	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29167438, 30986571		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	18985806	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25104095	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	26988986		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	15533933	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12519769, 35806055	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	14674991, 29409053		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31092016		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	31092016		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	34545328, 36175893	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31686145		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15494423, 16854822, 23536721, 24913641, 35790845	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22080164, 24179152, 24913641		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	31431503, 35790845	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22621920, 24179152, 27166183, 28030834, 34168220, 35790845	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15784732, 19398952, 19843865, 22258035, 22869869, 23748345, 24179152, 29162833, 30084282		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	11479205		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	21335544		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	21335544	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15707569, 21971960, 22564734, 22585575, 24002546, 24464213, 25643258, 26714930, 27350734, 30315225		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18247328		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21179472, 23275151, 24441772, 25535897, 25840419, 26438152, 29118324, 30607635, 35178291, 36714024	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25840419		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36306362	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21803008	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12071807, 24913641, 31064869		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24913641	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	21960592, 22102710	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	21960592		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	15526025		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34629418	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	28270495		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23839309, 31209198		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	25428911, 26439697, 29441438		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	21999571		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15951971, 18469532, 18823530, 20567916, 21401699, 21707865, 21730979, 23296058, 23844225, 24636978, 25111287, 25460505, 25468710, 26459098, 26850987, 28513990, 29075961, 29326282, 29356917, 30607635, 30816435, 31441116, 31448050, 31492187, 31601781		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25688741		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10469457, 31805725		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25837931		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10987268, 21291864, 24114124, 24418519, 26438152, 29118324, 30607635, 31044505		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21927021, 22641286, 23383610, 24240112, 25474241, 28847989, 28984489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19519883, 21289082, 23804422, 28440428, 29157102, 29286153, 30538111		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23027394, 24525428		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11691784, 25176258, 26867682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	31738907		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25349305, 26657501, 28049532		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11479205, 12781359, 15688426, 16928813, 17019715, 18084324, 18424430, 18671143, 19570909, 19716789, 20052416, 20567916, 20729914, 21034966, 21087899, 21707865, 21736880, 21892012, 22080164, 22713237, 23593991, 23613359, 23748345, 24072747, 24853431, 24913641, 25185187, 25257608, 25312395, 25349305, 25444911, 25458954, 25994202, 26054341, 26471831, 26544894, 27167194, 27556692, 27693461, 27815358, 27829224, 28000895, 28031537, 28049532, 28138032, 28270495, 28448462, 28847819, 28986587, 29054375, 29287241, 29301085, 29326282, 29596642, 29621769, 29684894, 29964052, 30573684, 30607635, 30629587, 30894677, 30982228, 31064869, 31294866, 31362335, 31362447, 31443367, 31669383, 31783714		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22469983, 25386925, 29621769, 29805632		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10469457, 12071807, 17408908, 17879369, 18671143, 28888100		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25688741		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22596349, 29075961, 29507695		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25688741		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25688741		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	25428911, 26439697, 29441438, 31064869		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	27449089, 28383788	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29753759, 31669383		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22391562, 23108403, 26054341, 27815358, 29535131, 30100999, 31044505		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	34281234, 37270643	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	19218339		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	22905093, 34580349	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19218339	Stimulate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	16217032		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	LHGDN	16217032		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	16217032	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly Primary Autosomal Recessive 1	Microcephaly	Pubtator	11481475, 16217032	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21148814, 22653969, 24913980		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21911831, 24594907, 25609078, 27010134, 31289205, 32060401, 33197893, 34782371	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19398952		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29149649		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20013349, 24117075, 24197116, 29568064		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24197116	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	26319201	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37904396	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10859164, 10987268, 11691784, 12124347, 12554671, 15526025, 16077986, 17019715, 17143490, 17879369, 18281511, 18698031, 19371427, 19716789, 19931410, 21034966, 21087899, 21154811, 21289082, 21289283, 21803008, 22117197, 22391562, 22469983, 22515193, 22585575, 22596349, 22713237, 22937147, 23242585, 23479505, 23593991, 23613359, 23804422, 24038068, 24072747, 24113549, 24197116, 24418519, 25149681, 25444911, 25878335, 26437225, 26471831, 26714930, 27512067, 27693461, 27993965, 28097235, 28106079, 28394262, 28604107, 28754670, 28881656, 29025359, 29167438, 29287241, 29535131, 29621769, 29940486, 30633885, 31294866, 31500184		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21289283, 23892435, 28270495, 28394338, 28604107, 29059438, 29805983, 31362335		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21289283, 23892435, 29805983, 31362335, 34807483	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22117197, 24113549, 24418519, 26295308, 27553023, 28625637, 29656007, 31140586		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	21401699		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22532985		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	39256343	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	17611684		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20590661, 25757065, 28000895, 28138032		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32033398, 40090437	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29707125		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21927021, 22641286, 23383610, 25474241, 28847989, 28984489		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22743332, 23383610	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23548269, 23575069, 24240112, 25104095, 25474241, 25884494, 26992217, 28591191, 29575713, 31409614, 33352723, 35741017, 35977930, 37048111, 38114660	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19519883, 21289082, 23804422, 28440428, 29157102, 29286153, 30538111		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30538111		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18381943, 19139112, 19401701, 19519883, 22134241, 22244109, 25002126	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25868389		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31497245		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	26542114, 31717700		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25132270		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23027394, 24525428		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15961392		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15961392, 24079846, 24525428, 31932554, 32459662, 36919124	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	25653093		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31092016		★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	20052416		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26474283		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	17050806, 20664703, 21628470, 28928282		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	20664703	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29409053		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	30282812, 31649026, 40478628	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23861893		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23861893		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23861893	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seckel syndrome	Seckel Syndrome	BEFREE	16217032		★☆☆☆☆ Found in Text Mining only
Seckel syndrome 1	Seckel syndrome	Pubtator	16217032	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	24913641	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10987268, 21894433, 28490518, 29138515, 30777870, 31375684		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	24934408, 25185187, 29845250, 33320980, 33504652, 34719665	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24142626, 29643063		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	18841153, 30633885		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24142626, 24327542	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28138028		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	29963769		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	14674991, 29409053		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11691784, 25176258, 26867682		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	37904396	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	11691784		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20401435, 21999571, 25972194, 26867682, 30260263, 32902196, 35902562, 36578802, 37904396	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25868389	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27329729	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	29391889		★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	BEFREE	17088560		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21707865, 22446188, 22812567, 23242585, 23825533, 24636978, 27815358, 28042876, 29075961, 29761796, 30352905, 30607635, 31492187		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23825533	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25104095, 27272773, 30607635, 31963582, 32294924, 35430566, 36720923, 36998242, 40037423, 40179432	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28751935		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27246979, 39892702	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	27191498		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25386925	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	30657978	Inhibit	★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	28098859	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	17088560, 30362123		★☆☆☆☆ Found in Text Mining only