Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11105
Gene name	PR/SET domain 7
Gene symbol	PRDM7
Synonyms (NCBI Gene)	PFM4ZNF910
Chromosome	16
Chromosome location	16q24.3
Summary	This gene encodes a member of a family of proteins that may have roles in transcription and other nuclear processes. The encoded protein contains a KRAB (Kruppel-associated box) domain -A box and a SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain and

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments
MIRT1260350	hsa-miR-183	CLIP-seq
MIRT1260351	hsa-miR-2467-3p	CLIP-seq
MIRT1260352	hsa-miR-3150b-3p	CLIP-seq
MIRT1260353	hsa-miR-3176	CLIP-seq
MIRT1260354	hsa-miR-3922-3p	CLIP-seq
MIRT1260355	hsa-miR-4320	CLIP-seq
MIRT1260356	hsa-miR-4773	CLIP-seq
MIRT1260357	hsa-miR-4784	CLIP-seq
MIRT1260358	hsa-miR-511	CLIP-seq
MIRT1260359	hsa-miR-513b	CLIP-seq
MIRT1260360	hsa-miR-615-5p	CLIP-seq
MIRT1260361	hsa-miR-885-3p	CLIP-seq
MIRT1260362	hsa-miR-922	CLIP-seq
MIRT2076661	hsa-miR-204	CLIP-seq
MIRT2076662	hsa-miR-211	CLIP-seq
MIRT2076663	hsa-miR-3170	CLIP-seq
MIRT2076664	hsa-miR-342-3p	CLIP-seq
MIRT2076665	hsa-miR-377	CLIP-seq
MIRT2076666	hsa-miR-4314	CLIP-seq
MIRT2076667	hsa-miR-4421	CLIP-seq
MIRT2076668	hsa-miR-4452	CLIP-seq
MIRT2076669	hsa-miR-4477b	CLIP-seq
MIRT2076670	hsa-miR-451b	CLIP-seq
MIRT2076671	hsa-miR-4665-3p	CLIP-seq
MIRT2076672	hsa-miR-4667-5p	CLIP-seq
MIRT2076673	hsa-miR-4696	CLIP-seq
MIRT2076674	hsa-miR-4700-5p	CLIP-seq
MIRT2076675	hsa-miR-4711-5p	CLIP-seq
MIRT1260358	hsa-miR-511	CLIP-seq
MIRT2076676	hsa-miR-545	CLIP-seq
MIRT2076677	hsa-miR-554	CLIP-seq
MIRT2076678	hsa-miR-637	CLIP-seq
MIRT2076679	hsa-miR-654-3p	CLIP-seq
MIRT2076680	hsa-miR-665	CLIP-seq
MIRT2076666	hsa-miR-4314	CLIP-seq
MIRT2076672	hsa-miR-4667-5p	CLIP-seq
MIRT2076674	hsa-miR-4700-5p	CLIP-seq
MIRT2076678	hsa-miR-637	CLIP-seq
MIRT2457115	hsa-miR-1182	CLIP-seq
MIRT2457116	hsa-miR-1236	CLIP-seq
MIRT2457117	hsa-miR-1257	CLIP-seq
MIRT2457118	hsa-miR-3120-5p	CLIP-seq
MIRT1260352	hsa-miR-3150b-3p	CLIP-seq
MIRT2457119	hsa-miR-3169	CLIP-seq
MIRT2457120	hsa-miR-3909	CLIP-seq
MIRT2457121	hsa-miR-4299	CLIP-seq
MIRT2457122	hsa-miR-4330	CLIP-seq
MIRT2457123	hsa-miR-4456	CLIP-seq
MIRT2457124	hsa-miR-4689	CLIP-seq
MIRT2457125	hsa-miR-4768-5p	CLIP-seq
MIRT1260357	hsa-miR-4784	CLIP-seq
MIRT2457126	hsa-miR-548q	CLIP-seq
MIRT2457127	hsa-miR-593	CLIP-seq
MIRT2457128	hsa-miR-759	CLIP-seq
MIRT2457129	hsa-miR-942	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0042054	Function	Histone methyltransferase activity	IEA
GO:0042800	Function	Histone H3K4 methyltransferase activity	IDA	27129774
GO:0042800	Function	Histone H3K4 methyltransferase activity	IEA

MIM	HGNC	e!Ensembl
609759	9351	ENSG00000126856

Q9NQW5

Protein name

Histone-lysine N-methyltransferase PRDM7 (EC 2.1.1.-) (PR domain zinc finger protein 7) (PR domain-containing protein 7) ([histone H3]-lysine4 N-methyltransferase PRDM7)

Protein function

Histone methyltransferase that selectively methylates 'Lys-4' of dimethylated histone H3 (H3K4me2) to produce trimethylated 'Lys-4' histone H3 (H3K4me3). May play a role in epigenetic regulation of gene expression by defining an active chromatin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	27 → 65	KRAB box	Family
PF09514	SSXRD	171 → 201	SSXRD motif	Motif

Sequence

MSPERSQEESPEGDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKMNYNA
LITVGLRATRPAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMAFRGEQSKHQKGMP
KASFNNESSLRELSGTPNLLNTSDSEQAQKPVSPPGEASTSGQHSRLKLELRRKETEGKM
YSLRERKGHAYKEISEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSAL
SLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANSGYSWLITKGRN
CYEYVDGKDKSSANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWSGDE
YGQELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHV
PHAVWPFQVKNFSVNMWNAITPLRTSQDHLQENFSNQRIPAQGIRIRSGNILIHAAVMTK
PKVKRSKKGPNS

Sequence length

492

Interactions

View interactions

	KEGG		Reactome
	Lysine degradation Metabolic pathways		Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Depressive Disorder	Major depressive disorder	Pubtator	34341332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRDM7 (PR/SET domain 7)