Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	11104
Gene name	Katanin catalytic subunit A1
Gene symbol	KATNA1
Synonyms (NCBI Gene)	-
Chromosome	6
Chromosome location	6q25.1
Summary	Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa

Show/Hide all (2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002617	hsa-miR-124-3p	Microarray	18668037
MIRT002617	hsa-miR-124-3p	Microarray	15685193

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000922	Component	Spindle pole	IDA	10751153, 19261606
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	19261606, 24486153, 26496610, 26929214, 28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19261606, 26929214
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IBA
GO:0005819	Component	Spindle	IDA	19261606
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0008017	Function	Microtubule binding	IDA	10751153
GO:0008017	Function	Microtubule binding	IEA
GO:0008352	Component	Katanin complex	IEA
GO:0008352	Component	Katanin complex	IPI	26929214
GO:0008568	Function	Microtubule severing ATPase activity	IBA
GO:0008568	Function	Microtubule severing ATPase activity	IDA	10751153
GO:0008568	Function	Microtubule severing ATPase activity	IEA
GO:0015630	Component	Microtubule cytoskeleton	NAS	28436967
GO:0016853	Function	Isomerase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030496	Component	Midbody	IDA	19261606
GO:0030496	Component	Midbody	IEA
GO:0031122	Process	Cytoplasmic microtubule organization	IDA	26929214
GO:0031122	Process	Cytoplasmic microtubule organization	NAS	28436967
GO:0046982	Function	Protein heterodimerization activity	IPI	10751153
GO:0051013	Process	Microtubule severing	IBA
GO:0051013	Process	Microtubule severing	IEA
GO:0051301	Process	Cell division	IEA
GO:0072686	Component	Mitotic spindle	IEA
GO:0097431	Component	Mitotic spindle pole	IDA	26929214

MIM	HGNC	e!Ensembl
606696	6216	ENSG00000186625

O75449

Protein name

Katanin p60 ATPase-containing subunit A1 (Katanin p60 subunit A1) (EC 5.6.1.1) (p60 katanin)

Protein function

Catalytic subunit of a complex which severs microtubules in an ATP-dependent manner. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. M

PDB

5ZQL , 5ZQM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00004	AAA	245 → 381	ATPase family associated with various cellular activities (AAA)	Domain
PF17862	AAA_lid_3	403 → 464	AAA+ lid domain	Domain
PF09336	Vps4_C	439 → 489	Vps4 C terminal oligomerisation domain	Domain

Sequence

MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEIN
VEAKHVKDIMKTLESFKLDSTPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQY
SDPKSHGNRPSTTVRVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETN
KFDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAVVLPMWMPEFFKGIRR
PWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFY
SPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATN
FPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGAD
ITNVCRDASLMAMRRRIEGLTPEEIRNLSKEEMHMPTTMEDFEMALKKVSKSVSAADIER
YEKWIFEFGSC

Sequence length

491

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	34981809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	27393504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30094535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30094535		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30094535		★★★★★ ★☆☆☆☆ Found in Text Mining only

KATNA1 (katanin catalytic subunit A1)