Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	11101
Gene name	Arginyltransferase 1
Gene symbol	ATE1
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10q26.13
Summary	This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin

Show/Hide all (44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018958	hsa-miR-335-5p	Microarray	18185580
MIRT020247	hsa-miR-130b-3p	Sequencing	20371350
MIRT051987	hsa-let-7b-5p	CLASH	23622248
MIRT804135	hsa-miR-1271	CLIP-seq
MIRT804136	hsa-miR-141	CLIP-seq
MIRT804137	hsa-miR-182	CLIP-seq
MIRT804138	hsa-miR-186	CLIP-seq
MIRT804139	hsa-miR-194	CLIP-seq
MIRT804140	hsa-miR-200a	CLIP-seq
MIRT804141	hsa-miR-219-1-3p	CLIP-seq
MIRT804142	hsa-miR-23a	CLIP-seq
MIRT804143	hsa-miR-23b	CLIP-seq
MIRT804144	hsa-miR-23c	CLIP-seq
MIRT804145	hsa-miR-2467-3p	CLIP-seq
MIRT804146	hsa-miR-3065-3p	CLIP-seq
MIRT804147	hsa-miR-3143	CLIP-seq
MIRT804148	hsa-miR-3662	CLIP-seq
MIRT804149	hsa-miR-4257	CLIP-seq
MIRT804150	hsa-miR-4682	CLIP-seq
MIRT804151	hsa-miR-4691-5p	CLIP-seq
MIRT804152	hsa-miR-4698	CLIP-seq
MIRT804153	hsa-miR-4719	CLIP-seq
MIRT804154	hsa-miR-543	CLIP-seq
MIRT804155	hsa-miR-571	CLIP-seq
MIRT804156	hsa-miR-873	CLIP-seq
MIRT804157	hsa-miR-885-3p	CLIP-seq
MIRT804158	hsa-miR-96	CLIP-seq
MIRT1937493	hsa-miR-2355-5p	CLIP-seq
MIRT804147	hsa-miR-3143	CLIP-seq
MIRT1937494	hsa-miR-3713	CLIP-seq
MIRT1937495	hsa-miR-3924	CLIP-seq
MIRT1937496	hsa-miR-4427	CLIP-seq
MIRT1937497	hsa-miR-4724-5p	CLIP-seq
MIRT804154	hsa-miR-543	CLIP-seq
MIRT804145	hsa-miR-2467-3p	CLIP-seq
MIRT804149	hsa-miR-4257	CLIP-seq
MIRT804156	hsa-miR-873	CLIP-seq
MIRT804135	hsa-miR-1271	CLIP-seq
MIRT804137	hsa-miR-182	CLIP-seq
MIRT804142	hsa-miR-23a	CLIP-seq
MIRT804143	hsa-miR-23b	CLIP-seq
MIRT804144	hsa-miR-23c	CLIP-seq
MIRT804157	hsa-miR-885-3p	CLIP-seq
MIRT804158	hsa-miR-96	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IBA
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IDA	34893540
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IEA
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	TAS	9858543
GO:0005515	Function	Protein binding	IPI	23455924, 28514442, 33961781
GO:0005634	Component	Nucleus	IDA	9858543
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9858543
GO:0005737	Component	Cytoplasm	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	34893540
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	34893540
GO:0006979	Process	Response to oxidative stress	IDA	34893540
GO:0006979	Process	Response to oxidative stress	IDA	34893540
GO:0010498	Process	Proteasomal protein catabolic process	IBA
GO:0010498	Process	Proteasomal protein catabolic process	IMP	25970626
GO:0016598	Process	Protein arginylation	NAS	9858543
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0044314	Process	Protein K27-linked ubiquitination	IDA	34893540
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	34893540
GO:0071211	Process	Protein targeting to vacuole involved in autophagy	IDA	34893540
GO:0071596	Process	Ubiquitin-dependent protein catabolic process via the N-end rule pathway	IDA	34893540

MIM	HGNC	e!Ensembl
607103	782	ENSG00000107669

O95260

Protein name

Arginyl-tRNA--protein transferase 1 (Arginyltransferase 1) (R-transferase 1) (EC 2.3.2.8) (Arginine-tRNA--protein transferase 1)

Protein function

Involved in the post-translational conjugation of arginine to the N-terminal aspartate or glutamate of a protein (PubMed:34893540). This arginylation is required for degradation of the protein via the ubiquitin pathway (PubMed:34893540). Does no

PDB

8TZV , 8UAU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04376	ATE_N	21 → 92	Arginine-tRNA-protein transferase, N terminus	Family
PF04377	ATE_C	290 → 429	Arginine-tRNA-protein transferase, C terminus	Family

Sequence

MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGK
YVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM
DDAVAGDFALINKLDIQCDLKTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSG
EPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPS
LFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPPSSQFKATLLESYQVYKRYQM
VIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILP
NCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKG
QYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIM
PYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRN

Sequence length

518

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATE1-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet ClinGen, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	33687501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33687501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	25381249, 31125336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36635225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of face	Facial dysmorphism	BEFREE	26114870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30177837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29916141, 30177837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35561126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30177837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31446431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30177837		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ATE1 (arginyltransferase 1)