Gene Gene information from NCBI Gene database.
Entrez ID 11070
Gene name Transmembrane protein 115
Gene symbol TMEM115
Synonyms (NCBI Gene)
PL6
Chromosome 3
Chromosome location 3p21.31
miRNA miRNA information provided by mirtarbase database.
118
miRTarBase ID miRNA Experiments Reference
MIRT051990 hsa-let-7b-5p CLASH 23622248
MIRT040622 hsa-miR-92b-3p CLASH 23622248
MIRT040155 hsa-miR-615-3p CLASH 23622248
MIRT037809 hsa-miR-455-3p CLASH 23622248
MIRT1430009 hsa-miR-1207-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0005515 Function Protein binding IPI 24806965, 25416956, 32296183, 32814053
GO:0005634 Component Nucleus IDA 17973242
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA 17973242
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607069 30055 ENSG00000126062
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12893
Protein name Transmembrane protein 115 (Placental protein 6) (Protein PL6)
Protein function May play a role in retrograde transport of proteins from the Golgi to the endoplasmic reticulum. May indirectly play a role in protein glycosylation in the Golgi.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08551 DUF1751 49 151 Eukaryotic integral membrane protein (DUF1751) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed strongly in kidney and skeletal muscle, followed by liver, placenta, pancreas, and lung, with low amounts in heart and only traces in brain (PubMed:11085536). Widely expressed with ubiquitous expression in epithelial tissues
Sequence
MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIW
TLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLT
YMASFNLVYLFTVRIHGALGFLGGVLVALKQ
TMGDCVVLRVPQVRVSVMPMLLLALLLLL
RLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLA
NLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVED
QSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL
Sequence length 351
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    COPI-mediated anterograde transport
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Carcinoma BEFREE 17973242
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 40552281 Associate
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 28551387
★☆☆☆☆
Found in Text Mining only
Mesothelioma Malignant Mesothelioma Pubtator 18973227 Associate
★☆☆☆☆
Found in Text Mining only
Pheochromocytoma Pheochromocytoma Pubtator 19110720 Associate
★☆☆☆☆
Found in Text Mining only