DEPP1 (DEPP autophagy regulator 1)

Gene

• Entrez ID: 11067
• Gene name: DEPP autophagy regulator 1
• Gene symbol: DEPP1
• Synonyms (NCBI Gene): C10orf10, DEPP, FIG, Fseg
• Chromosome: 10
• Chromosome location: 10q11.21
• Summary: The expression of this gene is induced by fasting as well as by progesterone. The protein encoded by this gene contains a t-synaptosome-associated protein receptor (SNARE) coiled-coil homology domain and a peroxisomal targeting signal. Production of the e

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IDA	25261981
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	25261981
GO:0005739	Component	Mitochondrion	IEA
GO:0005777	Component	Peroxisome	IDA	25261981
GO:0005777	Component	Peroxisome	IEA
GO:0006914	Process	Autophagy	IEA
GO:0010506	Process	Regulation of autophagy	IBA
GO:0010506	Process	Regulation of autophagy	IDA	28545464

Other IDs

• MIM: 611309
• HGNC: 23355
• e!Ensembl: ENSG00000165507

Protein

• UniProt ID: Q9NTK1
• Protein name: Protein DEPP1 (Decidual protein induced by progesterone) (Fasting-induced gene protein) (FIG)
• Protein function: Acts as a critical modulator of FOXO3-induced autophagy via increased cellular ROS.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15343	DEPP	25 → 212	Decidual protein induced by progesterone family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in various tissues, including pancreas, placenta, ovary, testis and kidney. {ECO:0000269|PubMed:16123073}.
• Sequence:

  MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQ
  GQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQR
  DLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTF
  GQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL

• Sequence length: 212

Pathways

KEGG:

FoxO signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPIDOSES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOIDOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bile duct carcinoma	Bile duct carcinoma	BEFREE	25231053		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24936657		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24936657	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24992173		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25231053		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25231053		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12661006		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12661006		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37385612	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24936657	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	21824253		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31963726, 37385612	Stimulate	★☆☆☆☆ Found in Text Mining only
Lipoidosis	Lipoidosis	CTD_human_DG	15342952, 16919414, 17175557		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24936657		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17486380, 29440765		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25261981, 28545464		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25261981, 28545464	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	38423139	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	14694500		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	31963726	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	16253638		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30278442	Associate	★☆☆☆☆ Found in Text Mining only