UBE2C (ubiquitin conjugating enzyme E2 C)

Gene

• Entrez ID: 11065
• Gene name: Ubiquitin conjugating enzyme E2 C
• Gene symbol: UBE2C
• Synonyms (NCBI Gene): UBCH10, dJ447F3.2
• Chromosome: 20
• Chromosome location: 20q13.12
• Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016310	hsa-miR-193b-3p	Microarray	20304954
MIRT021680	hsa-miR-140-3p	Sequencing	20371350
MIRT030369	hsa-miR-24-3p	Microarray	19748357
MIRT031394	hsa-miR-16-5p	Proteomics	18668040
MIRT050874	hsa-miR-17-5p	CLASH	23622248
MIRT050549	hsa-miR-20a-5p	CLASH	23622248
MIRT048197	hsa-miR-196a-5p	CLASH	23622248
MIRT040327	hsa-miR-615-3p	CLASH	23622248
MIRT039262	hsa-miR-671-5p	CLASH	23622248
MIRT050874	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	25760688
MIRT050874	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	25760688
MIRT050549	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25760688
MIRT050549	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25760688
MIRT736651	hsa-miR-381-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31646760
MIRT756334	hsa-miR-4429	Luciferase reporter assay, Western blotting, qRT-PCR	35866591
MIRT1467069	hsa-miR-300	CLIP-seq
MIRT1467070	hsa-miR-3188	CLIP-seq
MIRT1467071	hsa-miR-381	CLIP-seq
MIRT1467072	hsa-miR-4437	CLIP-seq
MIRT1467073	hsa-miR-4666-3p	CLIP-seq
MIRT1467074	hsa-miR-4729	CLIP-seq
MIRT1467075	hsa-miR-4775	CLIP-seq
MIRT1467076	hsa-miR-624	CLIP-seq
MIRT1467077	hsa-miR-889	CLIP-seq
MIRT2361098	hsa-miR-1276	CLIP-seq
MIRT2361099	hsa-miR-1284	CLIP-seq
MIRT2361100	hsa-miR-337-3p	CLIP-seq
MIRT2361101	hsa-miR-4311	CLIP-seq
MIRT2361102	hsa-miR-4719	CLIP-seq
MIRT2361103	hsa-miR-577	CLIP-seq
MIRT2361104	hsa-miR-583	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MED1	Unknown	21556051
MYC	Activation	22170434

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	15749827
GO:0000166	Function	Nucleotide binding	IEA
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18485873, 19820702, 19822757
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	20061386
GO:0005515	Function	Protein binding	IPI	19822757, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IDA	16413484, 18485873, 19822757
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	9122200, 18485873
GO:0010458	Process	Exit from mitosis	IMP	19822757
GO:0010994	Process	Free ubiquitin chain polymerization	IDA	19822757
GO:0016567	Process	Protein ubiquitination	IDA	9122200
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019787	Function	Ubiquitin-like protein transferase activity	IEA
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IBA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IBA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	9122200, 19822757
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	22017875, 22017876, 22017877
GO:0031536	Process	Positive regulation of exit from mitosis	IMP	9122200
GO:0032446	Process	Protein modification by small protein conjugation	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	27910872
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	27910872
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	15749827
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IDA	9637688
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IDA	12629039
GO:0051301	Process	Cell division	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	TAS
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IDA	12629039, 27910872
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	18485873, 19822757, 20061386, 27910872
GO:1904668	Process	Positive regulation of ubiquitin protein ligase activity	TAS	17443180

Other IDs

• MIM: 605574
• HGNC: 15937
• e!Ensembl: ENSG00000175063

Protein

• UniProt ID: O00762
• Protein name: Ubiquitin-conjugating enzyme E2 C (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme C) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme C) (UbcH10) (Ubiquitin carrier protein C) (Ubiquitin-protein ligase C)
• Protein function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C),
• PDB: 1I7K, 4YII, 5A31, 5KHR, 5L9U, 8TAR, 8TAU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00179	UQ_con	34 → 170	Ubiquitin-conjugating enzyme	Domain

• Sequence:

  MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF
  KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKE
  KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

• Sequence length: 179

Pathways

KEGG:

Ubiquitin mediated proteolysis

Reactome:

Inactivation of APC/C via direct inhibition of the APC/C complex
APC/C:Cdc20 mediated degradation of Cyclin B
Autodegradation of Cdh1 by Cdh1:APC/C
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
Regulation of APC/C activators between G1/S and early anaphase
APC/C:Cdc20 mediated degradation of mitotic proteins
Phosphorylation of the APC/C
APC-Cdc20 mediated degradation of Nek2A
Separation of Sister Chromatids
Senescence-Associated Secretory Phenotype (SASP)
CDK-mediated phosphorylation and removal of Cdc6
Transcriptional Regulation by VENTX
Synthesis of active ubiquitin: roles of E1 and E2 enzymes
Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	17217624		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22760214, 23102841		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	17217624		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	29303411		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16106252		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34918636, 37535572	Associate	★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	19438748		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	16106252		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	16106252, 18753363		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31715067		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	18331723		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	18666437	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	17217624		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23826418		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18666437	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17220641, 17933517, 19038004, 19438748, 19513072, 22056852, 24072565, 24114735, 24699941, 25739083, 26062455, 28881292, 29021715, 31670413		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17659439		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	17933517		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19038004, 22056852, 24699941, 25739083, 29685151, 33313822, 34620747, 34675265, 35124721, 37893423, 38643462, 39684488	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis	Calcinosis	Pubtator	24699941	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21338529, 31037155, 31715067, 33782624	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15208666, 23102841		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22997493, 30702595, 30914455, 32046048, 32685988, 32703154, 34238253, 34315286, 36882493, 37580802	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23826418		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23102841, 24815438, 25832867, 29904125, 30146342, 31037155		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31725636	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23355337, 29483831, 31715067	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31422942, 32309427, 33782624, 36385010	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	22388643	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38009019	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29575713, 31725636		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17243165, 20630075, 21338529		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17243165, 20630075, 21338529		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38102624	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16772118, 25917796		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16772118		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19779934, 20529090, 21514426, 23102841, 25376843, 25917796		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19302711, 19359472, 31173250, 36303457, 38637125	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31662448		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	28951454	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37335710, 37803076	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32443386, 34232175, 34488675, 35568702	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27556859, 34232175, 34488675, 37168048	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27588470	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	32685988	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	28260026		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15208666		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18666437	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19657671, 28767320, 31353228		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28767320	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22170434		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	27528424	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24699941	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19438748		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	31008954		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	36385010	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30480765	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17354233, 30914455, 31186759		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17354233		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19638491	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20065091, 29904125		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22388643, 24815438, 30146342, 34257576, 35178291, 35422093, 40282365	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23355337, 23587173, 35615976, 37335710	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29630110		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29630110, 31725636, 37168048	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31715067	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	19438748		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19438748		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17220641, 19038004, 19513072, 22056852, 24072565, 24114735, 24699941, 25739083, 26062455, 28881292, 29021715, 31670413		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17659439		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31662448		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31186759		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23102841, 24815438, 25832867, 29904125, 30146342, 31037155		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17016443, 29575713		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31715067		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21889355, 24512726, 25908644, 27550197, 31434609, 31646760		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25760688, 27349176, 28260026, 29630110, 30116193		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20544706		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23826418		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15208666, 17354233, 18331723, 19038004, 19438748, 19779934, 20065091, 20529090, 20544706, 20630075, 21454660, 22170434, 23102841, 23587173, 24699941, 27588470, 28881292, 29268240, 29630110, 29904125, 30641296, 30896844, 31186759, 31258721, 31353228		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17243165, 20630075, 21338529		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16772118		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17659439		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17659439		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17659439		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	28657121		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28657121, 31258721		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28560012		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33032291	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	37641028	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18570662, 23587173, 36576436, 39334908	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23587173		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	36576436	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12874022, 15208666, 17016443, 17217624, 17354233, 17624412, 17933517, 19038004, 19779934, 19885562, 20065091, 20529090, 20544706, 22170434, 23355337, 23587173, 23826418, 24512726, 25376843, 25832867, 27528424, 27550197, 27588470, 29021715, 29575713, 29904125, 30896844, 31008954, 31662448, 31679088, 31715067		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23251412		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23251412	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19638491, 22760214, 23102841, 25832867, 29904125, 30693031, 30896844, 31037155		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29575713		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29575713, 34577856, 40282365	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31715067		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23355337, 31715067		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29483831	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23355337		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	25432544	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21889355, 24512726, 25908644, 27550197, 31434609, 31646760		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33630978, 35409038, 36430352, 36834602, 38179769, 38226611, 39201599	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	29303411		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	22156612		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	33186389	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22760214		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27588470, 29268240, 29596365		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34198450, 35615976	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34950739, 36069832, 38096163	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25760688, 27349176, 28260026, 29630110, 30116193		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28260026	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29630110, 30804389, 32908877, 38062820, 40224213	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16106252, 17016443, 17933517, 20544706		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18753363		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20544706		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	20544706	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	20544706	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	23826418		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23201130, 23826418, 27528424	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21338529	Associate	★☆☆☆☆ Found in Text Mining only