Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	11062
Gene name	Dihydrouridine synthase 4 like
Gene symbol	DUS4L
Synonyms (NCBI Gene)	DUS4PP35
Chromosome	7
Chromosome location	7q22.3

Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023098	hsa-miR-124-3p	Microarray	18668037
MIRT947323	hsa-miR-1260	CLIP-seq
MIRT947324	hsa-miR-1260b	CLIP-seq
MIRT947325	hsa-miR-1283	CLIP-seq
MIRT947326	hsa-miR-1293	CLIP-seq
MIRT947327	hsa-miR-188-3p	CLIP-seq
MIRT947328	hsa-miR-216b	CLIP-seq
MIRT947329	hsa-miR-2278	CLIP-seq
MIRT947330	hsa-miR-3135	CLIP-seq
MIRT947331	hsa-miR-3145-5p	CLIP-seq
MIRT947332	hsa-miR-3152-5p	CLIP-seq
MIRT947333	hsa-miR-3156-3p	CLIP-seq
MIRT947334	hsa-miR-3618	CLIP-seq
MIRT947335	hsa-miR-3921	CLIP-seq
MIRT947336	hsa-miR-4301	CLIP-seq
MIRT947337	hsa-miR-4483	CLIP-seq
MIRT947338	hsa-miR-4649-3p	CLIP-seq
MIRT947339	hsa-miR-4653-5p	CLIP-seq
MIRT947340	hsa-miR-4773	CLIP-seq
MIRT947341	hsa-miR-4774-3p	CLIP-seq
MIRT947342	hsa-miR-508-5p	CLIP-seq
MIRT947343	hsa-miR-660	CLIP-seq
MIRT947344	hsa-miR-934	CLIP-seq
MIRT1980624	hsa-miR-1915	CLIP-seq
MIRT1980625	hsa-miR-193a-5p	CLIP-seq
MIRT947331	hsa-miR-3145-5p	CLIP-seq
MIRT1980626	hsa-miR-4314	CLIP-seq
MIRT1980627	hsa-miR-4726-3p	CLIP-seq
MIRT947342	hsa-miR-508-5p	CLIP-seq
MIRT1980628	hsa-miR-579	CLIP-seq
MIRT947344	hsa-miR-934	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002943	Process	TRNA dihydrouridine synthesis	IDA	34798057
GO:0002943	Process	TRNA dihydrouridine synthesis	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0017150	Function	TRNA dihydrouridine synthase activity	IBA
GO:0017150	Function	TRNA dihydrouridine synthase activity	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0102266	Function	TRNA-dihydrouridine20a synthase activity	IEA
GO:0102267	Function	TRNA-dihydrouridine20b synthase activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

O95620

Protein name

tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like (EC 1.3.1.90) (pp35) (tRNA-dihydrouridine synthase 4-like)

Protein function

Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01207	Dus	30 → 310	Dihydrouridine synthase (Dus)	Family

Sequence

MKSDCMQTTICQERKKDPIEMFHSGQLVKVCAPMVRYSKLAFRTLVRKYSCDLCYTPMIV
AADFVKSIKARDSEFTTNQGDCPLIVQFAANDARLLSDAARIVCPYANGIDINCGCPQRW
AMAEGYGACLINKPELVQDMVKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGV
SWITVHGRTAEERHQPVHYDSIKIIKENMSIPVIANGDIRSLKEAENVWRITGTDGVMVA
RGLLANPAMFAGYEETPLKCIWDWVDIALELGTPYMCFHQHLMYMMEKITSRQEKRVFNA
LSSTSAIIDYLTDHYGI

Sequence length

317

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COG5 CONGENITAL DISORDER OF GLYCOSYLATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISORDERS OF GLYCOSYLATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Degenerative polyarthritis	Arthritis	GWASDB_DG	21068099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASCAT_DG	21068099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22586168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24825461	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	36089590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28415823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DUS4L (dihydrouridine synthase 4 like)