WWP2 (WW domain containing E3 ubiquitin protein ligase 2)

Gene

• Entrez ID: 11060
• Gene name: WW domain containing E3 ubiquitin protein ligase 2
• Gene symbol: WWP2
• Synonyms (NCBI Gene): AIP2, WWp2-like
• Chromosome: 16
• Chromosome location: 16q22.1
• Summary: This gene encodes a member of the Nedd4 family of E3 ligases, which play an important role in protein ubiquitination. The encoded protein contains four WW domains and may play a role in multiple processes including chondrogenesis and the regulation of onc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052448	hsa-let-7a-5p	CLASH	23622248
MIRT050195	hsa-miR-26a-5p	CLASH	23622248
MIRT046361	hsa-miR-23b-3p	CLASH	23622248
MIRT040274	hsa-miR-615-3p	CLASH	23622248
MIRT488675	hsa-miR-637	PAR-CLIP	20371350
MIRT488674	hsa-miR-6853-5p	PAR-CLIP	20371350
MIRT488672	hsa-miR-1268a	PAR-CLIP	20371350
MIRT488670	hsa-miR-1268b	PAR-CLIP	20371350
MIRT488671	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT488669	hsa-miR-4488	PAR-CLIP	20371350
MIRT488668	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT488666	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT488667	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT488665	hsa-miR-328-5p	PAR-CLIP	20371350
MIRT488664	hsa-miR-6885-5p	PAR-CLIP	20371350
MIRT488663	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT488675	hsa-miR-637	PAR-CLIP	23592263
MIRT488674	hsa-miR-6853-5p	PAR-CLIP	23592263
MIRT488673	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT488672	hsa-miR-1268a	PAR-CLIP	23592263
MIRT488670	hsa-miR-1268b	PAR-CLIP	23592263
MIRT488671	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT488669	hsa-miR-4488	PAR-CLIP	23592263
MIRT488668	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT488666	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT488667	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT488665	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT488664	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT488663	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT488675	hsa-miR-637	PAR-CLIP	20371350
MIRT488674	hsa-miR-6853-5p	PAR-CLIP	20371350
MIRT488672	hsa-miR-1268a	PAR-CLIP	20371350
MIRT488670	hsa-miR-1268b	PAR-CLIP	20371350
MIRT488671	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT488669	hsa-miR-4488	PAR-CLIP	20371350
MIRT488668	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT488666	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT488667	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT488665	hsa-miR-328-5p	PAR-CLIP	20371350
MIRT488664	hsa-miR-6885-5p	PAR-CLIP	20371350
MIRT488663	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT488675	hsa-miR-637	PAR-CLIP	23592263
MIRT488674	hsa-miR-6853-5p	PAR-CLIP	23592263
MIRT488673	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT488672	hsa-miR-1268a	PAR-CLIP	23592263
MIRT488670	hsa-miR-1268b	PAR-CLIP	23592263
MIRT488671	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT488669	hsa-miR-4488	PAR-CLIP	23592263
MIRT488668	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT488666	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT488667	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT488665	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT488664	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT488663	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT1494886	hsa-miR-3180	CLIP-seq
MIRT1494887	hsa-miR-3180-3p	CLIP-seq
MIRT1494888	hsa-miR-3196	CLIP-seq
MIRT1494889	hsa-miR-4643	CLIP-seq
MIRT1494890	hsa-miR-4789-5p	CLIP-seq
MIRT1494891	hsa-miR-521	CLIP-seq
MIRT1494892	hsa-miR-127-5p	CLIP-seq
MIRT1494893	hsa-miR-3122	CLIP-seq
MIRT1494894	hsa-miR-3161	CLIP-seq
MIRT1494895	hsa-miR-3617	CLIP-seq
MIRT1494896	hsa-miR-3913-5p	CLIP-seq
MIRT1494897	hsa-miR-3977	CLIP-seq
MIRT1494898	hsa-miR-409-3p	CLIP-seq
MIRT1494899	hsa-miR-450b-3p	CLIP-seq
MIRT1494900	hsa-miR-4517	CLIP-seq
MIRT1494901	hsa-miR-4654	CLIP-seq
MIRT1494902	hsa-miR-4698	CLIP-seq
MIRT1494903	hsa-miR-4764-5p	CLIP-seq
MIRT1494904	hsa-miR-4769-5p	CLIP-seq
MIRT1494905	hsa-miR-4775	CLIP-seq
MIRT1494906	hsa-miR-576-5p	CLIP-seq
MIRT1494907	hsa-miR-590-3p	CLIP-seq
MIRT1494908	hsa-miR-641	CLIP-seq
MIRT1494909	hsa-miR-676	CLIP-seq
MIRT1494910	hsa-miR-769-3p	CLIP-seq
MIRT1494911	hsa-miR-1202	CLIP-seq
MIRT1494912	hsa-miR-1205	CLIP-seq
MIRT1494913	hsa-miR-1227	CLIP-seq
MIRT1494914	hsa-miR-137	CLIP-seq
MIRT1494915	hsa-miR-1539	CLIP-seq
MIRT1494916	hsa-miR-1827	CLIP-seq
MIRT1494917	hsa-miR-1909	CLIP-seq
MIRT1494918	hsa-miR-193a-3p	CLIP-seq
MIRT1494919	hsa-miR-193b	CLIP-seq
MIRT1494920	hsa-miR-2115	CLIP-seq
MIRT1494921	hsa-miR-219-5p	CLIP-seq
MIRT1494922	hsa-miR-2277-3p	CLIP-seq
MIRT1494923	hsa-miR-25	CLIP-seq
MIRT1494924	hsa-miR-3064-3p	CLIP-seq
MIRT1494925	hsa-miR-3065-3p	CLIP-seq
MIRT1494926	hsa-miR-31	CLIP-seq
MIRT1494927	hsa-miR-3120-3p	CLIP-seq
MIRT1494928	hsa-miR-3128	CLIP-seq
MIRT1494929	hsa-miR-3130-3p	CLIP-seq
MIRT1494930	hsa-miR-3136-5p	CLIP-seq
MIRT1494931	hsa-miR-3151	CLIP-seq
MIRT1494886	hsa-miR-3180	CLIP-seq
MIRT1494887	hsa-miR-3180-3p	CLIP-seq
MIRT1494932	hsa-miR-3192	CLIP-seq
MIRT1494933	hsa-miR-3193	CLIP-seq
MIRT1494934	hsa-miR-3194-5p	CLIP-seq
MIRT1494888	hsa-miR-3196	CLIP-seq
MIRT1494935	hsa-miR-32	CLIP-seq
MIRT1494936	hsa-miR-342-5p	CLIP-seq
MIRT1494937	hsa-miR-3609	CLIP-seq
MIRT1494938	hsa-miR-3620	CLIP-seq
MIRT1494939	hsa-miR-3621	CLIP-seq
MIRT1494940	hsa-miR-3622b-5p	CLIP-seq
MIRT1494941	hsa-miR-363	CLIP-seq
MIRT1494942	hsa-miR-3657	CLIP-seq
MIRT1494943	hsa-miR-367	CLIP-seq
MIRT1494944	hsa-miR-3688-5p	CLIP-seq
MIRT1494945	hsa-miR-3690	CLIP-seq
MIRT1494946	hsa-miR-3918	CLIP-seq
MIRT1494947	hsa-miR-3972	CLIP-seq
MIRT1494948	hsa-miR-4251	CLIP-seq
MIRT1494949	hsa-miR-4253	CLIP-seq
MIRT1494950	hsa-miR-4254	CLIP-seq
MIRT1494951	hsa-miR-4267	CLIP-seq
MIRT1494952	hsa-miR-4271	CLIP-seq
MIRT1494953	hsa-miR-4300	CLIP-seq
MIRT1494954	hsa-miR-4304	CLIP-seq
MIRT1494955	hsa-miR-4308	CLIP-seq
MIRT1494956	hsa-miR-4314	CLIP-seq
MIRT1494957	hsa-miR-4330	CLIP-seq
MIRT1494958	hsa-miR-4418	CLIP-seq
MIRT1494959	hsa-miR-4439	CLIP-seq
MIRT1494960	hsa-miR-4445	CLIP-seq
MIRT1494961	hsa-miR-4471	CLIP-seq
MIRT1494962	hsa-miR-4475	CLIP-seq
MIRT1494963	hsa-miR-4512	CLIP-seq
MIRT1494964	hsa-miR-4513	CLIP-seq
MIRT1494965	hsa-miR-4520a-3p	CLIP-seq
MIRT1494966	hsa-miR-4532	CLIP-seq
MIRT1494967	hsa-miR-4638-3p	CLIP-seq
MIRT1494968	hsa-miR-4646-5p	CLIP-seq
MIRT1494969	hsa-miR-4651	CLIP-seq
MIRT1494970	hsa-miR-4664-5p	CLIP-seq
MIRT1494971	hsa-miR-4669	CLIP-seq
MIRT1494972	hsa-miR-4725-3p	CLIP-seq
MIRT1494973	hsa-miR-4738-3p	CLIP-seq
MIRT1494974	hsa-miR-4743	CLIP-seq
MIRT1494975	hsa-miR-4747-5p	CLIP-seq
MIRT1494976	hsa-miR-4761-5p	CLIP-seq
MIRT1494977	hsa-miR-4762-5p	CLIP-seq
MIRT1494978	hsa-miR-4766-5p	CLIP-seq
MIRT1494979	hsa-miR-4782-3p	CLIP-seq
MIRT1494980	hsa-miR-4783-3p	CLIP-seq
MIRT1494981	hsa-miR-4787-5p	CLIP-seq
MIRT1494982	hsa-miR-485-5p	CLIP-seq
MIRT1494983	hsa-miR-486-3p	CLIP-seq
MIRT1494984	hsa-miR-488	CLIP-seq
MIRT1494985	hsa-miR-493	CLIP-seq
MIRT1494986	hsa-miR-508-3p	CLIP-seq
MIRT1494987	hsa-miR-509-3-5p	CLIP-seq
MIRT1494988	hsa-miR-509-5p	CLIP-seq
MIRT1494989	hsa-miR-512-5p	CLIP-seq
MIRT1494990	hsa-miR-520d-5p	CLIP-seq
MIRT1494991	hsa-miR-524-5p	CLIP-seq
MIRT1494992	hsa-miR-542-3p	CLIP-seq
MIRT1494993	hsa-miR-545	CLIP-seq
MIRT1494994	hsa-miR-548ah	CLIP-seq
MIRT1494995	hsa-miR-566	CLIP-seq
MIRT1494996	hsa-miR-580	CLIP-seq
MIRT1494997	hsa-miR-582-3p	CLIP-seq
MIRT1494998	hsa-miR-604	CLIP-seq
MIRT1494999	hsa-miR-608	CLIP-seq
MIRT1495000	hsa-miR-625	CLIP-seq
MIRT1495001	hsa-miR-647	CLIP-seq
MIRT1495002	hsa-miR-888	CLIP-seq
MIRT1495003	hsa-miR-920	CLIP-seq
MIRT1495004	hsa-miR-92a	CLIP-seq
MIRT1495005	hsa-miR-92b	CLIP-seq
MIRT1494982	hsa-miR-485-5p	CLIP-seq
MIRT2149095	hsa-miR-1226	CLIP-seq
MIRT1494946	hsa-miR-3918	CLIP-seq
MIRT1494963	hsa-miR-4512	CLIP-seq
MIRT2149096	hsa-miR-4733-3p	CLIP-seq
MIRT1494890	hsa-miR-4789-5p	CLIP-seq
MIRT2369615	hsa-miR-3678-5p	CLIP-seq
MIRT2369616	hsa-miR-4514	CLIP-seq
MIRT2369617	hsa-miR-4692	CLIP-seq
MIRT1494929	hsa-miR-3130-3p	CLIP-seq
MIRT1494946	hsa-miR-3918	CLIP-seq
MIRT1494952	hsa-miR-4271	CLIP-seq
MIRT1494966	hsa-miR-4532	CLIP-seq
MIRT1494972	hsa-miR-4725-3p	CLIP-seq
MIRT1494975	hsa-miR-4747-5p	CLIP-seq
MIRT1494985	hsa-miR-493	CLIP-seq
MIRT2369618	hsa-miR-548al	CLIP-seq
MIRT1495000	hsa-miR-625	CLIP-seq
MIRT2397063	hsa-miR-1470	CLIP-seq
MIRT2397064	hsa-miR-4446-5p	CLIP-seq
MIRT2397065	hsa-miR-4667-3p	CLIP-seq
MIRT2397066	hsa-miR-4755-5p	CLIP-seq
MIRT2397067	hsa-miR-642a	CLIP-seq
MIRT1494911	hsa-miR-1202	CLIP-seq
MIRT1494912	hsa-miR-1205	CLIP-seq
MIRT2149095	hsa-miR-1226	CLIP-seq
MIRT1494913	hsa-miR-1227	CLIP-seq
MIRT2663133	hsa-miR-1228	CLIP-seq
MIRT2663134	hsa-miR-1343	CLIP-seq
MIRT1494916	hsa-miR-1827	CLIP-seq
MIRT1494917	hsa-miR-1909	CLIP-seq
MIRT1494920	hsa-miR-2115	CLIP-seq
MIRT2663135	hsa-miR-298	CLIP-seq
MIRT1494924	hsa-miR-3064-3p	CLIP-seq
MIRT1494925	hsa-miR-3065-3p	CLIP-seq
MIRT1494926	hsa-miR-31	CLIP-seq
MIRT2663136	hsa-miR-3119	CLIP-seq
MIRT1494929	hsa-miR-3130-3p	CLIP-seq
MIRT1494931	hsa-miR-3151	CLIP-seq
MIRT2663137	hsa-miR-3155	CLIP-seq
MIRT2663138	hsa-miR-3155b	CLIP-seq
MIRT2663139	hsa-miR-3189-5p	CLIP-seq
MIRT1494934	hsa-miR-3194-5p	CLIP-seq
MIRT1494938	hsa-miR-3620	CLIP-seq
MIRT1494939	hsa-miR-3621	CLIP-seq
MIRT1494940	hsa-miR-3622b-5p	CLIP-seq
MIRT1494944	hsa-miR-3688-5p	CLIP-seq
MIRT1494946	hsa-miR-3918	CLIP-seq
MIRT1494947	hsa-miR-3972	CLIP-seq
MIRT1494949	hsa-miR-4253	CLIP-seq
MIRT1494950	hsa-miR-4254	CLIP-seq
MIRT2663140	hsa-miR-4293	CLIP-seq
MIRT1494955	hsa-miR-4308	CLIP-seq
MIRT2663141	hsa-miR-4327	CLIP-seq
MIRT1494958	hsa-miR-4418	CLIP-seq
MIRT1494961	hsa-miR-4471	CLIP-seq
MIRT1494962	hsa-miR-4475	CLIP-seq
MIRT1494899	hsa-miR-450b-3p	CLIP-seq
MIRT1494963	hsa-miR-4512	CLIP-seq
MIRT2663142	hsa-miR-4530	CLIP-seq
MIRT1494966	hsa-miR-4532	CLIP-seq
MIRT2663143	hsa-miR-4635	CLIP-seq
MIRT1494889	hsa-miR-4643	CLIP-seq
MIRT2663144	hsa-miR-4699-5p	CLIP-seq
MIRT2663145	hsa-miR-4709-3p	CLIP-seq
MIRT2663146	hsa-miR-4713-3p	CLIP-seq
MIRT2663147	hsa-miR-4727-5p	CLIP-seq
MIRT2663148	hsa-miR-4732-3p	CLIP-seq
MIRT2149096	hsa-miR-4733-3p	CLIP-seq
MIRT2663149	hsa-miR-4758-3p	CLIP-seq
MIRT1494977	hsa-miR-4762-5p	CLIP-seq
MIRT2663150	hsa-miR-4769-3p	CLIP-seq
MIRT2663151	hsa-miR-4772-5p	CLIP-seq
MIRT1494980	hsa-miR-4783-3p	CLIP-seq
MIRT1494981	hsa-miR-4787-5p	CLIP-seq
MIRT1494890	hsa-miR-4789-5p	CLIP-seq
MIRT2663152	hsa-miR-484	CLIP-seq
MIRT1494982	hsa-miR-485-5p	CLIP-seq
MIRT1494983	hsa-miR-486-3p	CLIP-seq
MIRT1494984	hsa-miR-488	CLIP-seq
MIRT1494987	hsa-miR-509-3-5p	CLIP-seq
MIRT1494988	hsa-miR-509-5p	CLIP-seq
MIRT2663153	hsa-miR-516a-3p	CLIP-seq
MIRT1494891	hsa-miR-521	CLIP-seq
MIRT2663154	hsa-miR-544	CLIP-seq
MIRT2663155	hsa-miR-572	CLIP-seq
MIRT1494998	hsa-miR-604	CLIP-seq
MIRT1495000	hsa-miR-625	CLIP-seq
MIRT2663156	hsa-miR-634	CLIP-seq
MIRT2663157	hsa-miR-638	CLIP-seq
MIRT2663158	hsa-miR-646	CLIP-seq
MIRT2663159	hsa-miR-718	CLIP-seq
MIRT1494910	hsa-miR-769-3p	CLIP-seq
MIRT1495002	hsa-miR-888	CLIP-seq
MIRT2663160	hsa-miR-935	CLIP-seq
MIRT2149095	hsa-miR-1226	CLIP-seq
MIRT2663134	hsa-miR-1343	CLIP-seq
MIRT1494916	hsa-miR-1827	CLIP-seq
MIRT1494920	hsa-miR-2115	CLIP-seq
MIRT1494925	hsa-miR-3065-3p	CLIP-seq
MIRT1494926	hsa-miR-31	CLIP-seq
MIRT1494929	hsa-miR-3130-3p	CLIP-seq
MIRT1494938	hsa-miR-3620	CLIP-seq
MIRT1494944	hsa-miR-3688-5p	CLIP-seq
MIRT1494950	hsa-miR-4254	CLIP-seq
MIRT2663140	hsa-miR-4293	CLIP-seq
MIRT1494955	hsa-miR-4308	CLIP-seq
MIRT2663141	hsa-miR-4327	CLIP-seq
MIRT1494962	hsa-miR-4475	CLIP-seq
MIRT2663142	hsa-miR-4530	CLIP-seq
MIRT1494966	hsa-miR-4532	CLIP-seq
MIRT1494889	hsa-miR-4643	CLIP-seq
MIRT2663148	hsa-miR-4732-3p	CLIP-seq
MIRT2149096	hsa-miR-4733-3p	CLIP-seq
MIRT1494977	hsa-miR-4762-5p	CLIP-seq
MIRT1494890	hsa-miR-4789-5p	CLIP-seq
MIRT1494982	hsa-miR-485-5p	CLIP-seq
MIRT1494984	hsa-miR-488	CLIP-seq
MIRT2663153	hsa-miR-516a-3p	CLIP-seq
MIRT1494891	hsa-miR-521	CLIP-seq
MIRT1494998	hsa-miR-604	CLIP-seq
MIRT2663156	hsa-miR-634	CLIP-seq
MIRT2663158	hsa-miR-646	CLIP-seq
MIRT1495002	hsa-miR-888	CLIP-seq
MIRT2663160	hsa-miR-935	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19274063
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS	15047715
GO:0000151	Component	Ubiquitin ligase complex	TAS	9647693
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	19274063, 19651900, 24105792
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IMP	18776082
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	9169421
GO:0005515	Function	Protein binding	IPI	9647693, 15231748, 16189514, 18729074, 18776082, 19274063, 20858735, 21258410, 21516116, 21572392, 21847096, 22315426, 23236378, 25416956, 25910212, 26871637, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781, 34927784, 35156780, 35271311, 36931259, 38270169
GO:0005634	Component	Nucleus	IDA	19274063
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	15047715
GO:0005829	Component	Cytosol	TAS
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006858	Process	Extracellular transport	IMP	22315426
GO:0008134	Function	Transcription factor binding	IPI	19651900
GO:0010629	Process	Negative regulation of gene expression	IMP	18776082
GO:0016020	Component	Membrane	HDA	19946888
GO:0016567	Process	Protein ubiquitination	IDA	26280536
GO:0016567	Process	Protein ubiquitination	IDA	18776082
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IMP	22315426
GO:0016740	Function	Transferase activity	IEA
GO:0019870	Function	Potassium channel inhibitor activity	IDA	17289006
GO:0032410	Process	Negative regulation of transporter activity	IDA	18776082
GO:0034765	Process	Regulation of monoatomic ion transmembrane transport	IBA
GO:0036211	Process	Protein modification process	TAS	9169421
GO:0042391	Process	Regulation of membrane potential	IDA	17289006
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	19274063
GO:0044325	Function	Transmembrane transporter binding	IPI	17289006
GO:0045746	Process	Negative regulation of Notch signaling pathway	TAS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS	15047715
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046718	Process	Symbiont entry into host cell	TAS	12450395
GO:0051224	Process	Negative regulation of protein transport	IMP	18776082
GO:0051865	Process	Protein autoubiquitination	IDA	24105792
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IBA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	19274063
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS	15047715
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070534	Process	Protein K63-linked ubiquitination	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	ISS
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	ISS	15047715
GO:1903765	Process	Negative regulation of potassium ion export across plasma membrane	IDA	17289006

Other IDs

• MIM: 602308
• HGNC: 16804
• e!Ensembl: ENSG00000198373

Protein

• UniProt ID: O00308
• Protein name: NEDD4-like E3 ubiquitin-protein ligase WWP2 (EC 2.3.2.26) (Atrophin-1-interacting protein 2) (AIP2) (HECT-type E3 ubiquitin transferase WWP2) (WW domain-containing protein 2)
• Protein function: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Polyubiquitinates POU5F1 by 'Lys-63'-linked conjugation and
• PDB: 4Y07, 5TJ7, 5TJ8, 5TJQ, 6J1Z, 6RSS, 8EI5, 8EI6, 8EI7, 8EI8, 9EQH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00397	WW	302 → 331	WW domain	Domain
  PF00397	WW	332 → 361	WW domain	Domain
  PF00397	WW	407 → 435	WW domain	Domain
  PF00397	WW	446 → 475	WW domain	Domain
  PF00632	HECT	565 → 870	HECT-domain (ubiquitin-transferase)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in heart, throughout the brain, placenta, lung, liver, muscle, kidney and pancreas. Also detected in spleen and peripheral blood leukocytes. {ECO:0000269|PubMed:19274063, ECO:0000269|PubMed:9647693}.
• Sequence:

  MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRI
  GSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLT
  LNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQ
  PPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPT
  TATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPD
  ALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQR
  PTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQDNGRV
  YYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE
  SGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDL
  RRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPD
  HLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKE
  NNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQ
  TKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWFW
  QVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFN
  RLDLPPYKSYEQLREKLLYAIEETEGFGQE

• Sequence length: 870

Pathways

KEGG:

Ubiquitin mediated proteolysis

Reactome:

Regulation of PTEN stability and activity
NOTCH3 Activation and Transmission of Signal to the Nucleus

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPONDYLOEPIPHYSEAL DYSPLASIA, CRANIOSYNOSTOSIS, CLEFT PALATE, CATARACT AND INTELLECTUAL DISABILITY SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYNOVITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYNOVIUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27462019		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28578701		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29925997		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26783238		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23938591, 36795754, 40004017	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	30899409		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31430374		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25356737		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	31399586		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage Diseases	BEFREE	21750408		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	21750408	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21750408, 24257415, 31160553		★☆☆☆☆ Found in Text Mining only
Fasciitis, Plantar	Plantar fasciitis	GWASCAT_DG	29534260		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Plantar	Fibromatosis	GWASCAT_DG	29534260		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31621893		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29237971		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29237971	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36208715	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	31103287	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36211818	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37557169	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	30899409		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26662306, 26783238		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31430374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25356737		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23938591		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31677789		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23938591, 25356737, 26783238, 30415470, 31578285		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23938591	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31399586		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	21750408, 25356737, 26662306, 27462019, 29685889, 30016585, 30415470		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21750408, 24257415, 30298554, 31173883, 36208715, 37749624	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	37749624	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	37749624	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	GWASCAT_DG	30374069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis, Knee	Knee osteoarthritis	CTD_human_DG	30374069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	25356737		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23938591		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29237971	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	40591616	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31677789		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36803368	Associate	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	31399586		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★☆☆☆☆ Found in Text Mining only