ASDURF (ASNSD1 upstream open reading frame)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 110599588
Gene name ASNSD1 upstream open reading frame
Gene symbol ASDURF
Synonyms (NCBI Gene)
ASNSD1ASNSD1-SEPNS3TP1
Chromosome 2
Chromosome location 2q32.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0032991 Component Protein-containing complex IEA
GO:0050821 Process Protein stabilization NAS 31738558
GO:1990062 Component RPAP3/R2TP/prefoldin-like complex IPI 31738558
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619740 53619 ENSG00000286053
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
L0R819
Protein name ASNSD1 upstream open reading frame protein (ASNSD1 small/short open reading frame-encoded polypeptide) (ASNSD1-SEP)
Family and domains
Sequence 
MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRKVYRQQQNSNIF
FLADRTEMLSESKNILDELKKEYQEIENLDKTKIKK
Sequence length 96
Interactions View interactions

No strongly related genes found yet for ASDURF.

No additional diseases found yet through genes similar to ASDURF.