WWP1 (WW domain containing E3 ubiquitin protein ligase 1)

Gene

• Entrez ID: 11059
• Gene name: WW domain containing E3 ubiquitin protein ligase 1
• Gene symbol: WWP1
• Synonyms (NCBI Gene): AIP5, Tiul1, hSDRP1
• Chromosome: 8
• Chromosome location: 8q21.3
• Summary: WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tande

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052949	hsa-miR-21-5p	qRT-PCR, Western blot	22227207
MIRT716074	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT716073	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT716074	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT716073	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT1494864	hsa-miR-103a	CLIP-seq
MIRT1494865	hsa-miR-107	CLIP-seq
MIRT1494866	hsa-miR-1343	CLIP-seq
MIRT1494867	hsa-miR-15a	CLIP-seq
MIRT1494868	hsa-miR-15b	CLIP-seq
MIRT1494869	hsa-miR-16	CLIP-seq
MIRT1494870	hsa-miR-195	CLIP-seq
MIRT1494871	hsa-miR-21	CLIP-seq
MIRT1494872	hsa-miR-3074-5p	CLIP-seq
MIRT1494873	hsa-miR-3613-3p	CLIP-seq
MIRT1494874	hsa-miR-424	CLIP-seq
MIRT1494875	hsa-miR-4310	CLIP-seq
MIRT1494876	hsa-miR-4421	CLIP-seq
MIRT1494877	hsa-miR-4530	CLIP-seq
MIRT1494878	hsa-miR-4704-3p	CLIP-seq
MIRT1494879	hsa-miR-4704-5p	CLIP-seq
MIRT1494880	hsa-miR-4789-5p	CLIP-seq
MIRT1494881	hsa-miR-4796-3p	CLIP-seq
MIRT1494882	hsa-miR-497	CLIP-seq
MIRT1494883	hsa-miR-498	CLIP-seq
MIRT1494884	hsa-miR-548t	CLIP-seq
MIRT1494885	hsa-miR-590-5p	CLIP-seq
MIRT2149081	hsa-miR-19a	CLIP-seq
MIRT2149082	hsa-miR-19b	CLIP-seq
MIRT2149083	hsa-miR-3664-3p	CLIP-seq
MIRT2149084	hsa-miR-374c	CLIP-seq
MIRT2149085	hsa-miR-4433	CLIP-seq
MIRT2149086	hsa-miR-4459	CLIP-seq
MIRT2149087	hsa-miR-4475	CLIP-seq
MIRT2149088	hsa-miR-4539	CLIP-seq
MIRT1494879	hsa-miR-4704-5p	CLIP-seq
MIRT2149089	hsa-miR-4719	CLIP-seq
MIRT2149090	hsa-miR-4762-3p	CLIP-seq
MIRT2149091	hsa-miR-4768-3p	CLIP-seq
MIRT1494880	hsa-miR-4789-5p	CLIP-seq
MIRT2149092	hsa-miR-578	CLIP-seq
MIRT2149093	hsa-miR-655	CLIP-seq
MIRT2149094	hsa-miR-891b	CLIP-seq
MIRT1494864	hsa-miR-103a	CLIP-seq
MIRT1494865	hsa-miR-107	CLIP-seq
MIRT2369589	hsa-miR-1208	CLIP-seq
MIRT2369590	hsa-miR-142-5p	CLIP-seq
MIRT1494867	hsa-miR-15a	CLIP-seq
MIRT1494868	hsa-miR-15b	CLIP-seq
MIRT1494869	hsa-miR-16	CLIP-seq
MIRT1494870	hsa-miR-195	CLIP-seq
MIRT1494871	hsa-miR-21	CLIP-seq
MIRT2369591	hsa-miR-3614-5p	CLIP-seq
MIRT2369592	hsa-miR-3647-3p	CLIP-seq
MIRT2369593	hsa-miR-3652	CLIP-seq
MIRT2149084	hsa-miR-374c	CLIP-seq
MIRT2369594	hsa-miR-3924	CLIP-seq
MIRT1494874	hsa-miR-424	CLIP-seq
MIRT1494875	hsa-miR-4310	CLIP-seq
MIRT2369595	hsa-miR-4420	CLIP-seq
MIRT1494876	hsa-miR-4421	CLIP-seq
MIRT2369596	hsa-miR-4430	CLIP-seq
MIRT2369597	hsa-miR-4505	CLIP-seq
MIRT1494877	hsa-miR-4530	CLIP-seq
MIRT2369598	hsa-miR-4687-3p	CLIP-seq
MIRT1494878	hsa-miR-4704-3p	CLIP-seq
MIRT1494879	hsa-miR-4704-5p	CLIP-seq
MIRT2369599	hsa-miR-4731-5p	CLIP-seq
MIRT1494880	hsa-miR-4789-5p	CLIP-seq
MIRT2369600	hsa-miR-4790-3p	CLIP-seq
MIRT1494882	hsa-miR-497	CLIP-seq
MIRT1494883	hsa-miR-498	CLIP-seq
MIRT2369601	hsa-miR-548a-5p	CLIP-seq
MIRT2369602	hsa-miR-548ab	CLIP-seq
MIRT2369603	hsa-miR-548ak	CLIP-seq
MIRT2369604	hsa-miR-548b-5p	CLIP-seq
MIRT2369605	hsa-miR-548c-5p	CLIP-seq
MIRT2369606	hsa-miR-548d-5p	CLIP-seq
MIRT2369607	hsa-miR-548h	CLIP-seq
MIRT2369608	hsa-miR-548i	CLIP-seq
MIRT2369609	hsa-miR-548j	CLIP-seq
MIRT2369610	hsa-miR-548k	CLIP-seq
MIRT2369611	hsa-miR-548w	CLIP-seq
MIRT2369612	hsa-miR-548y	CLIP-seq
MIRT2369613	hsa-miR-559	CLIP-seq
MIRT2149092	hsa-miR-578	CLIP-seq
MIRT1494885	hsa-miR-590-5p	CLIP-seq
MIRT2369614	hsa-miR-647	CLIP-seq
MIRT2149093	hsa-miR-655	CLIP-seq
MIRT2149088	hsa-miR-4539	CLIP-seq
MIRT2149090	hsa-miR-4762-3p	CLIP-seq
MIRT1494876	hsa-miR-4421	CLIP-seq
MIRT1494883	hsa-miR-498	CLIP-seq
MIRT1494876	hsa-miR-4421	CLIP-seq
MIRT1494877	hsa-miR-4530	CLIP-seq
MIRT1494883	hsa-miR-498	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	NAS	9169421
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	9169421, 9647693
GO:0005515	Function	Protein binding	IPI	9647693, 16189514, 19447967, 19580544, 25416956, 25910212, 29892012, 32296183, 32814053, 33961781, 35271311, 38270169
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0007165	Process	Signal transduction	NAS	9169421
GO:0007417	Process	Central nervous system development	NAS	9647693
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	TAS	12535537
GO:0016740	Function	Transferase activity	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046718	Process	Symbiont entry into host cell	TAS	12450395
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070161	Component	Anchoring junction	IEA

Other IDs

• MIM: 602307
• HGNC: 17004
• e!Ensembl: ENSG00000123124

Protein

• UniProt ID: Q9H0M0
• Protein name: NEDD4-like E3 ubiquitin-protein ligase WWP1 (EC 2.3.2.26) (Atrophin-1-interacting protein 5) (AIP5) (HECT-type E3 ubiquitin transferase WWP1) (TGIF-interacting ubiquitin ligase 1) (Tiul1) (WW domain-containing protein 1)
• Protein function: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Ubiquitinates ERBB4 isoforms JM-A CYT-1 and JM-B CYT-1, KLF2
• PDB: 1ND7, 2OP7, 5HPS, 5HPT, 6J1X, 6J1Y, 8EI4, 9EQK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00168	C2	18 → 118	C2 domain	Domain
  PF00397	WW	351 → 380	WW domain	Domain
  PF00397	WW	383 → 412	WW domain	Domain
  PF00397	WW	458 → 487	WW domain	Domain
  PF00397	WW	498 → 527	WW domain	Domain
  PF00632	HECT	617 → 922	HECT-domain (ubiquitin-transferase)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in heart, placenta, pancreas, kidney, liver, skeletal muscle, bone marrow, fetal brain, and at much lower levels in adult brain and lung. Isoform 1 and isoform 5 predominate in all tissues tested, except in testis and bone mar
• Sequence:

  MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEITKTAKSSSSS
  NPKWDEQLTVNVTPQTTLEFQVWSHRTLKADALLGKATIDLKQALLIHNRKLERVKEQLK
  LSLENKNGIAQTGELTVVLDGLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTAR
  LAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADD
  TVNGESSSFAPTDNASVTGTPVVSEENALSPNCTSTTVEDPPVQEILTSSENNECIPSTS
  AELESEARSILEPDTSNSRSSSAFEAAKSRQPDGCMDPVRQQSGNANTETLPSGWEQRKD
  PHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNF
  EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTK
  TTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQ
  IAYERGFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIF
  RGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFI
  GRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGL
  EMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGF
  NEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN
  EVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYK
  SYEQLKEKLLFAIEETEGFGQE

• Sequence length: 922

Pathways

KEGG:

Ubiquitin mediated proteolysis
Endocytosis

Reactome:

Downregulation of ERBB4 signaling
Stimuli-sensing channels
Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wolff-Parkinson-White pattern	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WOLFF-PARKINSON-WHITE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	18724389		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27315426		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27315426		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28495464		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17330240, 18604872, 18724389, 19267401, 21480222		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20139910, 22629406, 25417742	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25293520, 26506518	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26506518, 36168627, 36899918, 37997542	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34348693	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27315426		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37597669	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29511596		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30978403		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	31057023	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27107943		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	31348766	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31348766		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29209041		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24792179, 26506518, 27838634		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24792179		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35154481	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25293520	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17330240, 18604872, 18724389, 19267401, 21480222, 24792179		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17016436, 22629406, 25051198, 27070713		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28431583, 30417502		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17016436, 24792179, 26152726, 27070713, 29511596, 30213861, 31097636		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17330240, 18604872		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17330240		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus syndrome congenital	Melanocytic nevus	Pubtator	34912899	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	23849376	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	29635000		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17016436, 17330240, 18604872, 19267401, 25293520, 27315426, 29209041, 29511596, 29888632, 30417502, 31097636		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	19267401		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29518962		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29518962	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26339351		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17016436, 25051198, 27070713		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26152726, 27070713	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29888632		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25293520, 28431583, 30417502		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25293520, 33124951	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40280416	Associate	★☆☆☆☆ Found in Text Mining only