LILRA1 (leukocyte immunoglobulin like receptor A1)

Gene

• Entrez ID: 11024
• Gene name: Leukocyte immunoglobulin like receptor A1
• Gene symbol: LILRA1
• Synonyms (NCBI Gene): CD85I, LIR-6, LIR6
• Chromosome: 19
• Chromosome location: 19q13.42
• Summary: This gene encodes an activating member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein is predominantly expressed in B cells, interacts with major histocompati

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018055	hsa-miR-335-5p	Microarray	18185580
MIRT1109242	hsa-miR-1324	CLIP-seq
MIRT1109243	hsa-miR-3166	CLIP-seq
MIRT1109244	hsa-miR-3662	CLIP-seq
MIRT1109245	hsa-miR-455-3p	CLIP-seq
MIRT1109246	hsa-miR-509-3p	CLIP-seq
MIRT1109247	hsa-miR-548c-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0003823	Function	Antigen binding	TAS	9548455
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9548455
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006952	Process	Defense response	TAS	9548455
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9548455
GO:0016020	Component	Membrane	IEA
GO:0032396	Function	Inhibitory MHC class I receptor activity	IBA
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IBA

Other IDs

• MIM: 604810
• HGNC: 6602
• e!Ensembl: ENSG00000104974

Protein

• UniProt ID: O75019
• Protein name: Leukocyte immunoglobulin-like receptor subfamily A member 1 (CD85 antigen-like family member I) (Leukocyte immunoglobulin-like receptor 6) (LIR-6) (CD antigen CD85i)
• Protein function: May act as receptor for class I MHC antigens.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	28 → 118	Immunoglobulin domain	Domain
  PF13895	Ig_2	325 → 419	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in monocytes and B-cells. {ECO:0000269|PubMed:9548455}.
• Sequence:

  MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRL
  YREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTG
  AYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRA
  IFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGE
  SLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGA
  YNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKA
  GAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVS
  GAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLF
  EAQHSQRSL

• Sequence length: 489

Pathways

KEGG:

Osteoclast differentiation
B cell receptor signaling pathway

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GENERALIZED ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18273033		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	27777418		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30673676		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18273033		★☆☆☆☆ Found in Text Mining only