Gene Gene information from NCBI Gene database.
Entrez ID 11010
Gene name GLI pathogenesis related 1
Gene symbol GLIPR1
Synonyms (NCBI Gene)
CRISP7GLIPRRTVP1
Chromosome 12
Chromosome location 12q21.2
Summary This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage a
miRNA miRNA information provided by mirtarbase database.
259
miRTarBase ID miRNA Experiments Reference
MIRT020639 hsa-miR-155-5p Proteomics 18668040
MIRT028463 hsa-miR-30a-5p Proteomics 18668040
MIRT053056 hsa-miR-137 Luciferase reporter assayqRT-PCRWestern blot 23714687
MIRT1020966 hsa-miR-103a CLIP-seq
MIRT1020967 hsa-miR-107 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 32814053, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005886 Component Plasma membrane TAS
GO:0016020 Component Membrane HDA 19946888
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602692 17001 ENSG00000139278
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P48060
Protein name Glioma pathogenesis-related protein 1 (GliPR 1) (Protein RTVP-1)
PDB 3Q2R , 3Q2U
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00188 CAP 38 175 Cysteine-rich secretory protein family Domain
Tissue specificity TISSUE SPECIFICITY: According to PubMed:8973356, it is ubiquitously expressed with high levels in lung and kidney and low levels in heart and liver. Highly expressed in cell lines derived from nervous system tumors arising from glia, low or absent in non-
Sequence
MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTW
DPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDE
IQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNY
GPGGN
YPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIV
NSVILILSVIITILVQHKYPNLVLLD
Sequence length 266
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    PPARA activates gene expression
Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
WILMS TUMOR CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute monocytic leukemia Monocytic Leukemia BEFREE 24008279
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 28771580
★☆☆☆☆
Found in Text Mining only
Amyloidosis Amyloidosis Pubtator 27069257 Associate
★☆☆☆☆
Found in Text Mining only
Anaplastic Oligodendroglioma Anaplastic Oligodendroglioma BEFREE 17825796
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma BEFREE 17825796, 7607567
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Autism Pubtator 26398136 Associate
★☆☆☆☆
Found in Text Mining only
Bilateral Wilms Tumor Wilms tumor CTD_human_DG 18030365
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 23433894, 28799673
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain neoplasms Pubtator 21931216 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 23433894, 28799673
★☆☆☆☆
Found in Text Mining only