Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	11009
Gene name	Interleukin 24
Gene symbol	IL24
Synonyms (NCBI Gene)	C49AFISPIL10BMDA7MOB5ST16
Chromosome	1
Chromosome location	1q32.1
Summary	This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of

188

Show/Hide all (188)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005563	hsa-miR-205-5p	Luciferase reporter assayqRT-PCRWestern blot	20737563
MIRT005563	hsa-miR-205-5p	Luciferase reporter assayqRT-PCRWestern blot	20737563
MIRT006858	hsa-miR-203a-3p	Luciferase reporter assay	22917968
MIRT006858	hsa-miR-203a-3p	Luciferase reporter assay	22917968
MIRT005563	hsa-miR-205-5p	Luciferase reporter assay	23212344
MIRT1064659	hsa-miR-2054	CLIP-seq
MIRT1064660	hsa-miR-3121-3p	CLIP-seq
MIRT1064661	hsa-miR-1224-3p	CLIP-seq
MIRT1064662	hsa-miR-1260	CLIP-seq
MIRT1064663	hsa-miR-1260b	CLIP-seq
MIRT1064664	hsa-miR-1280	CLIP-seq
MIRT1064665	hsa-miR-154	CLIP-seq
MIRT1064666	hsa-miR-3689a-5p	CLIP-seq
MIRT1064667	hsa-miR-3689b	CLIP-seq
MIRT1064668	hsa-miR-3689e	CLIP-seq
MIRT1064669	hsa-miR-3689f	CLIP-seq
MIRT1064670	hsa-miR-4464	CLIP-seq
MIRT1064671	hsa-miR-4733-5p	CLIP-seq
MIRT1064672	hsa-miR-4748	CLIP-seq
MIRT1064673	hsa-miR-490-5p	CLIP-seq
MIRT1064674	hsa-miR-624	CLIP-seq
MIRT2015375	hsa-miR-203	CLIP-seq
MIRT2015376	hsa-miR-425	CLIP-seq
MIRT2015377	hsa-miR-495	CLIP-seq
MIRT2015378	hsa-miR-642b	CLIP-seq
MIRT2389369	hsa-miR-3183	CLIP-seq
MIRT2389370	hsa-miR-324-5p	CLIP-seq
MIRT2389371	hsa-miR-4723-3p	CLIP-seq
MIRT2389372	hsa-miR-642a	CLIP-seq
MIRT2551148	hsa-miR-1185	CLIP-seq
MIRT2551149	hsa-miR-1224-5p	CLIP-seq
MIRT2551150	hsa-miR-1268	CLIP-seq
MIRT2551151	hsa-miR-1268b	CLIP-seq
MIRT2551152	hsa-miR-1293	CLIP-seq
MIRT2551153	hsa-miR-1321	CLIP-seq
MIRT2551154	hsa-miR-1343	CLIP-seq
MIRT2551155	hsa-miR-1825	CLIP-seq
MIRT2551156	hsa-miR-186	CLIP-seq
MIRT2551157	hsa-miR-198	CLIP-seq
MIRT2551158	hsa-miR-199a-5p	CLIP-seq
MIRT2551159	hsa-miR-199b-5p	CLIP-seq
MIRT2015375	hsa-miR-203	CLIP-seq
MIRT1064659	hsa-miR-2054	CLIP-seq
MIRT2551160	hsa-miR-27a	CLIP-seq
MIRT2551161	hsa-miR-27b	CLIP-seq
MIRT2551162	hsa-miR-300	CLIP-seq
MIRT2551163	hsa-miR-3117-5p	CLIP-seq
MIRT1064660	hsa-miR-3121-3p	CLIP-seq
MIRT2551164	hsa-miR-3133	CLIP-seq
MIRT2551165	hsa-miR-3137	CLIP-seq
MIRT2551166	hsa-miR-3153	CLIP-seq
MIRT2551167	hsa-miR-3160-3p	CLIP-seq
MIRT2551168	hsa-miR-3162-5p	CLIP-seq
MIRT2551169	hsa-miR-3173-3p	CLIP-seq
MIRT2551170	hsa-miR-3190	CLIP-seq
MIRT2551171	hsa-miR-3202	CLIP-seq
MIRT2551172	hsa-miR-342-5p	CLIP-seq
MIRT2551173	hsa-miR-3605-5p	CLIP-seq
MIRT2551174	hsa-miR-3616-3p	CLIP-seq
MIRT2551175	hsa-miR-3616-5p	CLIP-seq
MIRT2551176	hsa-miR-3646	CLIP-seq
MIRT2551177	hsa-miR-3647-5p	CLIP-seq
MIRT2551178	hsa-miR-3649	CLIP-seq
MIRT2551179	hsa-miR-3663-5p	CLIP-seq
MIRT2551180	hsa-miR-3679-5p	CLIP-seq
MIRT2551181	hsa-miR-381	CLIP-seq
MIRT2551182	hsa-miR-3915	CLIP-seq
MIRT2551183	hsa-miR-3926	CLIP-seq
MIRT2551184	hsa-miR-412	CLIP-seq
MIRT2015376	hsa-miR-425	CLIP-seq
MIRT2551185	hsa-miR-4305	CLIP-seq
MIRT2551186	hsa-miR-4419a	CLIP-seq
MIRT2551187	hsa-miR-4461	CLIP-seq
MIRT2551188	hsa-miR-4476	CLIP-seq
MIRT2551189	hsa-miR-4483	CLIP-seq
MIRT2551190	hsa-miR-4487	CLIP-seq
MIRT2551191	hsa-miR-4510	CLIP-seq
MIRT2551192	hsa-miR-452	CLIP-seq
MIRT2551193	hsa-miR-4640-5p	CLIP-seq
MIRT2551194	hsa-miR-4651	CLIP-seq
MIRT2551195	hsa-miR-4664-5p	CLIP-seq
MIRT2551196	hsa-miR-4668-5p	CLIP-seq
MIRT2551197	hsa-miR-4676-3p	CLIP-seq
MIRT2551198	hsa-miR-4686	CLIP-seq
MIRT2551199	hsa-miR-4689	CLIP-seq
MIRT2551200	hsa-miR-4699-5p	CLIP-seq
MIRT2551201	hsa-miR-4716-3p	CLIP-seq
MIRT2551202	hsa-miR-4720-3p	CLIP-seq
MIRT2551203	hsa-miR-4723-5p	CLIP-seq
MIRT2551204	hsa-miR-4726-5p	CLIP-seq
MIRT2551205	hsa-miR-4728-5p	CLIP-seq
MIRT2551206	hsa-miR-4739	CLIP-seq
MIRT2551207	hsa-miR-4755-3p	CLIP-seq
MIRT2551208	hsa-miR-4756-5p	CLIP-seq
MIRT2551209	hsa-miR-4779	CLIP-seq
MIRT2551210	hsa-miR-4792	CLIP-seq
MIRT2551211	hsa-miR-4795-5p	CLIP-seq
MIRT2551212	hsa-miR-4804-3p	CLIP-seq
MIRT2015377	hsa-miR-495	CLIP-seq
MIRT2551213	hsa-miR-500a	CLIP-seq
MIRT2551214	hsa-miR-513a-5p	CLIP-seq
MIRT2551215	hsa-miR-514	CLIP-seq
MIRT2551216	hsa-miR-514b-3p	CLIP-seq
MIRT2551217	hsa-miR-520a-5p	CLIP-seq
MIRT2551218	hsa-miR-525-5p	CLIP-seq
MIRT2551219	hsa-miR-548s	CLIP-seq
MIRT2551220	hsa-miR-558	CLIP-seq
MIRT2551221	hsa-miR-573	CLIP-seq
MIRT2551222	hsa-miR-574-5p	CLIP-seq
MIRT2551223	hsa-miR-601	CLIP-seq
MIRT2551224	hsa-miR-608	CLIP-seq
MIRT2551225	hsa-miR-617	CLIP-seq
MIRT2015378	hsa-miR-642b	CLIP-seq
MIRT2551226	hsa-miR-668	CLIP-seq
MIRT2551227	hsa-miR-7	CLIP-seq
MIRT2551228	hsa-miR-711	CLIP-seq
MIRT2551229	hsa-miR-942	CLIP-seq
MIRT2551150	hsa-miR-1268	CLIP-seq
MIRT2551151	hsa-miR-1268b	CLIP-seq
MIRT2551153	hsa-miR-1321	CLIP-seq
MIRT2551154	hsa-miR-1343	CLIP-seq
MIRT2551155	hsa-miR-1825	CLIP-seq
MIRT2551156	hsa-miR-186	CLIP-seq
MIRT2551157	hsa-miR-198	CLIP-seq
MIRT2551158	hsa-miR-199a-5p	CLIP-seq
MIRT2551159	hsa-miR-199b-5p	CLIP-seq
MIRT2015375	hsa-miR-203	CLIP-seq
MIRT1064659	hsa-miR-2054	CLIP-seq
MIRT2551162	hsa-miR-300	CLIP-seq
MIRT2551163	hsa-miR-3117-5p	CLIP-seq
MIRT1064660	hsa-miR-3121-3p	CLIP-seq
MIRT2551164	hsa-miR-3133	CLIP-seq
MIRT2551165	hsa-miR-3137	CLIP-seq
MIRT2551166	hsa-miR-3153	CLIP-seq
MIRT2551167	hsa-miR-3160-3p	CLIP-seq
MIRT2551168	hsa-miR-3162-5p	CLIP-seq
MIRT2551169	hsa-miR-3173-3p	CLIP-seq
MIRT2551170	hsa-miR-3190	CLIP-seq
MIRT2551171	hsa-miR-3202	CLIP-seq
MIRT2551172	hsa-miR-342-5p	CLIP-seq
MIRT2551174	hsa-miR-3616-3p	CLIP-seq
MIRT2551175	hsa-miR-3616-5p	CLIP-seq
MIRT2551177	hsa-miR-3647-5p	CLIP-seq
MIRT2551178	hsa-miR-3649	CLIP-seq
MIRT2551179	hsa-miR-3663-5p	CLIP-seq
MIRT2551181	hsa-miR-381	CLIP-seq
MIRT2551183	hsa-miR-3926	CLIP-seq
MIRT2551184	hsa-miR-412	CLIP-seq
MIRT2015376	hsa-miR-425	CLIP-seq
MIRT2551185	hsa-miR-4305	CLIP-seq
MIRT2551186	hsa-miR-4419a	CLIP-seq
MIRT2551188	hsa-miR-4476	CLIP-seq
MIRT2551190	hsa-miR-4487	CLIP-seq
MIRT2551191	hsa-miR-4510	CLIP-seq
MIRT2551192	hsa-miR-452	CLIP-seq
MIRT2551193	hsa-miR-4640-5p	CLIP-seq
MIRT2551194	hsa-miR-4651	CLIP-seq
MIRT2551195	hsa-miR-4664-5p	CLIP-seq
MIRT2551197	hsa-miR-4676-3p	CLIP-seq
MIRT2551200	hsa-miR-4699-5p	CLIP-seq
MIRT2551201	hsa-miR-4716-3p	CLIP-seq
MIRT2551202	hsa-miR-4720-3p	CLIP-seq
MIRT2551203	hsa-miR-4723-5p	CLIP-seq
MIRT2551204	hsa-miR-4726-5p	CLIP-seq
MIRT2551205	hsa-miR-4728-5p	CLIP-seq
MIRT2551206	hsa-miR-4739	CLIP-seq
MIRT2551207	hsa-miR-4755-3p	CLIP-seq
MIRT2551208	hsa-miR-4756-5p	CLIP-seq
MIRT2551209	hsa-miR-4779	CLIP-seq
MIRT2551210	hsa-miR-4792	CLIP-seq
MIRT2551211	hsa-miR-4795-5p	CLIP-seq
MIRT2551212	hsa-miR-4804-3p	CLIP-seq
MIRT2015377	hsa-miR-495	CLIP-seq
MIRT2551213	hsa-miR-500a	CLIP-seq
MIRT2551215	hsa-miR-514	CLIP-seq
MIRT2551216	hsa-miR-514b-3p	CLIP-seq
MIRT2551219	hsa-miR-548s	CLIP-seq
MIRT2551220	hsa-miR-558	CLIP-seq
MIRT2551221	hsa-miR-573	CLIP-seq
MIRT2551222	hsa-miR-574-5p	CLIP-seq
MIRT2551223	hsa-miR-601	CLIP-seq
MIRT2551224	hsa-miR-608	CLIP-seq
MIRT2551225	hsa-miR-617	CLIP-seq
MIRT2015378	hsa-miR-642b	CLIP-seq
MIRT2551226	hsa-miR-668	CLIP-seq
MIRT2551227	hsa-miR-7	CLIP-seq
MIRT2551228	hsa-miR-711	CLIP-seq
MIRT2551229	hsa-miR-942	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CEBPB	Unknown	10942517
JUN	Unknown	21357535

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	25640309
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	9826712
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071353	Process	Cellular response to interleukin-4	IEA

MIM	HGNC	e!Ensembl
604136	11346	ENSG00000162892

Q13007

Protein name

Interleukin-24 (IL-24) (Melanoma differentiation-associated gene 7 protein) (MDA-7) (Suppression of tumorigenicity 16 protein)

Protein function

Multifunctional cytokine mainly produced by T-cells that plays a regulatory role in immune response, tissue homeostasis, host defense, and oncogenesis (PubMed:25168428, PubMed:27687232). Possesses antiviral functions and induces the type I inter

PDB

6DF3 , 6GG1

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Up-regulated in melanoma cells induced to terminally differentiate.

Sequence

MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ
VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV
FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL
DVEAALTKALGEVDILLTWMQKFYKL

Sequence length

206

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor JAK-STAT signaling pathway		Interleukin-20 family signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (200)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18046450, 22025528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15709189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25479732, 27687232, 28109288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22025528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30112030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	17263806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	30190424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	30755657		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24236457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	23094074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26968800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28572467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19710636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24552169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20061404, 21073280, 27271601, 30761646, 31152679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	30755657		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26883473, 28599419, 28849038, 31289468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30985757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20103619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	25091574	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16172403, 16282987, 21394107, 21546925, 22640485, 23468528, 23546515, 23720015, 24042845, 25150001, 26031207, 26460950, 26474456, 28187446, 30424508, 9826712 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037, 21671747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12907143, 15851011, 16710719, 21546925, 28187446, 29749438, 30424508, 36766731	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	29686678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29415639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	29415639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	29330517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11526239, 11704829, 14647471, 15580305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16586551, 20872968, 22899557, 26320498, 26361419, 27528029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29484443	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30985757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11956076, 12085234, 15684712, 15713900, 15851010, 17024233, 17235306, 18059175, 19734998, 20574150, 21660060, 21794078, 23170786, 25775124, 27208781, 29048638, 31783569 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19417161, 35915803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24270662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28461326	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15297172, 15833826, 16225913, 16646087, 27349517		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18299662, 22471469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18299662, 22471469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22025528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31802235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16408101, 18941194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	18941194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	17305874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24527982	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20354907, 22820863, 31311100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16000066, 16799468, 16924242, 24892445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18277093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12883035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24552169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24552169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19535621, 24527982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24527982	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19399182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	24211183, 29528494, 30755657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33321923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	23768573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24552169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30112030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	36806964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30981108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30981108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	21109977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	20163249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	17263806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	31743516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18281516, 18376144, 20103619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18281516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20107314, 20179672, 37280571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12960112, 15197348, 18281516, 18376144, 20103619, 20107314, 20179672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12606943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12960112, 18281515, 18299661, 18376144, 19363468, 20103619, 23794295, 26168134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15197348, 18281515, 23794295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20179672, 26168134, 37280571	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29420334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	18468766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	30934002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	31768752, 31834503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24552169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37753073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20686970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19535621, 24527982, 29551126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24527982	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	24211183, 29528494, 30755657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	28330899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31802235		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18468766, 19730452, 21282359, 28599419, 29420334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20858700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	20858700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20858700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	31145345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	22588557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16586551, 17627414, 18842498, 20596089, 20697855, 20872968, 20939432, 21134831, 21835849, 21979578, 21988227, 22569271, 22635106, 22790965, 22899557 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17627414, 18842498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21835849, 22635106, 31849466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29703138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12085234, 12907143, 15006602, 15093181, 15684712, 17235306, 17431123, 19734998, 25775124, 26009991		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	12085234		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	12830052, 15713900		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	12830052, 12907143, 15006602, 15851011, 26009991, 27602961, 27931220, 29048638	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	15093181, 18059175, 25775124	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24130510, 31023128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	23546515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	18046450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18468766, 28849038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34334531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19087313		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	19087313		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	12606943, 20179672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	20137089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16172403, 16282987, 21394107, 21546925, 22640485, 23468528, 23546515, 23720015, 24042845, 25150001, 26031207, 26460950, 26474456, 28187446, 30424508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037, 21671747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30981108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	21109977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18636209, 19666410, 20596089, 21835849, 21979578, 22790965, 31289468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11956076, 12085234, 15684712, 15713900, 15851010, 17024233, 17111370, 17235306, 18059175, 19734998, 21794078, 23170786, 25775124, 27208781, 31783569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	12830052, 15713900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15297172, 15833826, 16225913, 16646087, 27349517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15580305, 15851011, 18768668, 19080270, 25452327, 26977011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	15580305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14647471, 15578066, 16331261, 17545625, 19888195, 19950222, 20150932, 20406981, 20737563, 21610321, 21671747, 21732348, 26323436, 29934341, 30519344, 30580153, 31262898 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	14678967, 21671747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19916746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30985757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11175318, 11471572, 11704829, 11844832, 11850799, 12395925, 12485618, 12654260, 12811827, 14647471, 15120649, 15194048, 15273727, 15304100, 15334067 View all (78 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18299662, 22471469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20354907, 22820863, 31311100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037, 21671747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16282987, 22640485, 26460950, 26474456, 9826712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037, 21671747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037, 21671747		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10381256, 10713678, 10942517, 11175318, 11471572, 11526239, 11668478, 11704829, 11844832, 11850799, 11956076, 12085234, 12114539, 12395925, 12485618 View all (124 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	11844832, 12533668, 12606943, 15564140, 19056673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12114539, 15304100, 15851011, 18511292, 19056673, 20216471, 20383178, 22027907, 23430584, 29048638, 32246006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15564140, 18074024	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	12606823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	20137089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	10942517, 11850799, 12533668, 15304100, 17208263, 20216471		★★★★★ ★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	22588557, 28192118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20179672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	23212344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	18046450, 26225923, 29420334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18468766, 26097559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	26354610	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23783436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	19910452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11175318, 11471572, 11668478, 11844832, 12085234, 12485618, 12533668, 12606823, 12907143, 15006602, 15093181, 15120649, 15126330, 15194048, 15300212 View all (131 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	31023128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23609032, 23692552, 24084981, 28599451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	22392969, 30414958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11175318, 12409262, 15194048, 15273727, 17111370, 21660060, 27519412, 30798161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26251997, 28599451, 28942243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28942243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15297172		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15297172, 15833826, 16225913, 16646087, 27349517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16646087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19910452	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	30580153, 30798161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11526239, 15580305, 15851011, 18768668, 18771346, 19080270, 25452327, 25990458, 26977011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	15580305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15851011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15851011, 17360670, 25452327, 25990458	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18768668	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis, Chronic	Pancreatitis	BEFREE	21922126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	17305874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35154475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	18046450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14647471, 15126330, 15578066, 16331261, 17545625, 19888195, 19950222, 20150932, 20406981, 20737563, 21610321, 21671747, 21732348, 26323436, 29934341, 30519344, 30580153, 31262898 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	14678967, 21671747		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20406981, 20737563, 21524313, 21610321	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21671747		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26528857	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prune Belly Syndrome	Prune belly syndrome	BEFREE	30580153, 30798161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	15667561, 20072629, 30301277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15889129, 17074928, 17263806, 20712572, 24211183, 28150860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	17263806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12883035, 20948318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	20574150, 8799171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	30190424, 31462501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	31462501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18061474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	26577568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	Pubtator	26577568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	39940697	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28516843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17278711, 19731362, 23768573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	28369789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15709189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24270662, 28461326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25091574, 34326893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32623386	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25091574, 28805796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19916746, 20163249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19535621, 24527982, 31311100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	19087313		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	BEFREE	29208545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18299662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27271601, 29681905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	18717682, 20699607		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	18717682, 20699607		★★★★★ ★☆☆☆☆ Found in Text Mining only

IL24 (interleukin 24)