CCDC85B (coiled-coil domain containing 85B)

Gene

• Entrez ID: 11007
• Gene name: Coiled-coil domain containing 85B
• Gene symbol: CCDC85B
• Synonyms (NCBI Gene): DIPA
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: Hepatitis delta virus (HDV) is a pathogenic human virus whose RNA genome and replication cycle resemble those of plant viroids. Delta-interacting protein A (DIPA), a cellular gene product, has been found to have homology to hepatitis delta virus antigen (

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2195079	hsa-miR-4540	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 17014843, 17873903, 22666460, 25009281, 25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17014843, 17873903, 25009281
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	17014843
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005912	Component	Adherens junction	IDA	25009281
GO:0005912	Component	Adherens junction	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030308	Process	Negative regulation of cell growth	IDA	17873903
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	17014843
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0070097	Function	Delta-catenin binding	IPI	25009281
GO:0070161	Component	Anchoring junction	IEA

Other IDs

• MIM: 605360
• HGNC: 24926
• e!Ensembl: ENSG00000175602

Protein

• UniProt ID: Q15834
• Protein name: Coiled-coil domain-containing protein 85B (Hepatitis delta antigen-interacting protein A) (Delta-interacting protein A)
• Protein function: Functions as a transcriptional repressor (PubMed:17014843). May inhibit the activity of CTNNB1 in a TP53-dependent manner and thus regulate cell growth (PubMed:17873903). May function in adipocyte differentiation, negatively regulating mitotic c
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10226	CCDC85	5 → 193	CCDC85 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed including liver.
• Sequence:

  MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEI
  RELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKL
  AELEGRQEELLRENLALKELCLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGD
  GSSSTGSVGSPDQLPLACSPDD

• Sequence length: 202

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma of lung	Lung carcinoma	BEFREE	30242906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30242906		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30242906		★☆☆☆☆ Found in Text Mining only