KIF2C (kinesin family member 2C)

Gene

• Entrez ID: 11004
• Gene name: Kinesin family member 2C
• Gene symbol: KIF2C
• Synonyms (NCBI Gene): CT139, KNSL6, MCAK
• Chromosome: 1
• Chromosome location: 1p34.1
• Summary: This gene encodes a kinesin-like protein that functions as a microtubule-dependent molecular motor. The encoded protein can depolymerize microtubules at the plus end, thereby promoting mitotic chromosome segregation. Alternative splicing results in multip

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016679	hsa-miR-423-3p	Sequencing	20371350
MIRT019473	hsa-miR-148b-3p	Microarray	17612493
MIRT023058	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT024025	hsa-miR-1-3p	Proteomics	18668040
MIRT025335	hsa-miR-34a-5p	Proteomics	21566225
MIRT025335	hsa-miR-34a-5p	Proteomics	21566225
MIRT027317	hsa-miR-101-3p	Sequencing	20371350
MIRT031974	hsa-miR-16-5p	Proteomics	18668040
MIRT050506	hsa-miR-20a-5p	CLASH	23622248
MIRT049563	hsa-miR-92a-3p	CLASH	23622248
MIRT138452	hsa-miR-4484	PAR-CLIP	23592263
MIRT138427	hsa-miR-181a-5p	PAR-CLIP	23592263
MIRT138428	hsa-miR-181b-5p	PAR-CLIP	23592263
MIRT138429	hsa-miR-181c-5p	PAR-CLIP	23592263
MIRT138435	hsa-miR-181d-5p	PAR-CLIP	23592263
MIRT138449	hsa-miR-4262	PAR-CLIP	23592263
MIRT138447	hsa-miR-3154	PAR-CLIP	23592263
MIRT138463	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT138426	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT019473	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT138430	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT138432	hsa-miR-186-3p	PAR-CLIP	23592263
MIRT138460	hsa-miR-6075	PAR-CLIP	23592263
MIRT016679	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT138446	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT138464	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT455914	hsa-miR-4276	PAR-CLIP	23592263
MIRT455913	hsa-miR-1303	PAR-CLIP	23592263
MIRT138440	hsa-miR-583	PAR-CLIP	23592263
MIRT455912	hsa-miR-548a-5p	PAR-CLIP	23592263
MIRT455911	hsa-miR-548ab	PAR-CLIP	23592263
MIRT455910	hsa-miR-548ad-5p	PAR-CLIP	23592263
MIRT455909	hsa-miR-548ae-5p	PAR-CLIP	23592263
MIRT455908	hsa-miR-548ak	PAR-CLIP	23592263
MIRT455907	hsa-miR-548am-5p	PAR-CLIP	23592263
MIRT455906	hsa-miR-548ap-5p	PAR-CLIP	23592263
MIRT455905	hsa-miR-548aq-5p	PAR-CLIP	23592263
MIRT455904	hsa-miR-548ar-5p	PAR-CLIP	23592263
MIRT455903	hsa-miR-548as-5p	PAR-CLIP	23592263
MIRT455902	hsa-miR-548au-5p	PAR-CLIP	23592263
MIRT455901	hsa-miR-548ay-5p	PAR-CLIP	23592263
MIRT455900	hsa-miR-548b-5p	PAR-CLIP	23592263
MIRT455899	hsa-miR-548bb-5p	PAR-CLIP	23592263
MIRT455898	hsa-miR-548c-5p	PAR-CLIP	23592263
MIRT455897	hsa-miR-548d-5p	PAR-CLIP	23592263
MIRT455896	hsa-miR-548h-5p	PAR-CLIP	23592263
MIRT455895	hsa-miR-548i	PAR-CLIP	23592263
MIRT455894	hsa-miR-548j-5p	PAR-CLIP	23592263
MIRT455893	hsa-miR-548o-5p	PAR-CLIP	23592263
MIRT455892	hsa-miR-548w	PAR-CLIP	23592263
MIRT455891	hsa-miR-548y	PAR-CLIP	23592263
MIRT455890	hsa-miR-559	PAR-CLIP	23592263
MIRT138459	hsa-miR-548av-5p	PAR-CLIP	23592263
MIRT138444	hsa-miR-548k	PAR-CLIP	23592263
MIRT138465	hsa-miR-8054	PAR-CLIP	23592263
MIRT455889	hsa-miR-548l	PAR-CLIP	23592263
MIRT138462	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT455888	hsa-miR-1321	PAR-CLIP	23592263
MIRT455887	hsa-miR-4739	PAR-CLIP	23592263
MIRT455886	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT138451	hsa-miR-3675-3p	PAR-CLIP	23592263
MIRT138439	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT455885	hsa-miR-4330	PAR-CLIP	23592263
MIRT455884	hsa-miR-517-5p	PAR-CLIP	23592263
MIRT455883	hsa-miR-1251-5p	PAR-CLIP	23592263
MIRT138434	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT138455	hsa-miR-4645-3p	PAR-CLIP	23592263
MIRT138453	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT138448	hsa-miR-3162-5p	PAR-CLIP	23592263
MIRT455882	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT455881	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT138427	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT138428	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT138429	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT138435	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT138452	hsa-miR-4484	PAR-CLIP	23592263
MIRT138427	hsa-miR-181a-5p	PAR-CLIP	23592263
MIRT138428	hsa-miR-181b-5p	PAR-CLIP	23592263
MIRT138429	hsa-miR-181c-5p	PAR-CLIP	23592263
MIRT138435	hsa-miR-181d-5p	PAR-CLIP	23592263
MIRT138449	hsa-miR-4262	PAR-CLIP	23592263
MIRT138447	hsa-miR-3154	PAR-CLIP	23592263
MIRT138463	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT138426	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT019473	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT138430	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT138432	hsa-miR-186-3p	PAR-CLIP	23592263
MIRT138460	hsa-miR-6075	PAR-CLIP	23592263
MIRT016679	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT138446	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT138464	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT455914	hsa-miR-4276	PAR-CLIP	23592263
MIRT455913	hsa-miR-1303	PAR-CLIP	23592263
MIRT138440	hsa-miR-583	PAR-CLIP	23592263
MIRT455912	hsa-miR-548a-5p	PAR-CLIP	23592263
MIRT455911	hsa-miR-548ab	PAR-CLIP	23592263
MIRT455910	hsa-miR-548ad-5p	PAR-CLIP	23592263
MIRT455909	hsa-miR-548ae-5p	PAR-CLIP	23592263
MIRT455908	hsa-miR-548ak	PAR-CLIP	23592263
MIRT455907	hsa-miR-548am-5p	PAR-CLIP	23592263
MIRT455906	hsa-miR-548ap-5p	PAR-CLIP	23592263
MIRT455905	hsa-miR-548aq-5p	PAR-CLIP	23592263
MIRT455904	hsa-miR-548ar-5p	PAR-CLIP	23592263
MIRT455903	hsa-miR-548as-5p	PAR-CLIP	23592263
MIRT455902	hsa-miR-548au-5p	PAR-CLIP	23592263
MIRT455901	hsa-miR-548ay-5p	PAR-CLIP	23592263
MIRT455900	hsa-miR-548b-5p	PAR-CLIP	23592263
MIRT455899	hsa-miR-548bb-5p	PAR-CLIP	23592263
MIRT455898	hsa-miR-548c-5p	PAR-CLIP	23592263
MIRT455897	hsa-miR-548d-5p	PAR-CLIP	23592263
MIRT455896	hsa-miR-548h-5p	PAR-CLIP	23592263
MIRT455895	hsa-miR-548i	PAR-CLIP	23592263
MIRT455894	hsa-miR-548j-5p	PAR-CLIP	23592263
MIRT455893	hsa-miR-548o-5p	PAR-CLIP	23592263
MIRT455892	hsa-miR-548w	PAR-CLIP	23592263
MIRT455891	hsa-miR-548y	PAR-CLIP	23592263
MIRT455890	hsa-miR-559	PAR-CLIP	23592263
MIRT138459	hsa-miR-548av-5p	PAR-CLIP	23592263
MIRT138444	hsa-miR-548k	PAR-CLIP	23592263
MIRT138465	hsa-miR-8054	PAR-CLIP	23592263
MIRT455889	hsa-miR-548l	PAR-CLIP	23592263
MIRT138462	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT455888	hsa-miR-1321	PAR-CLIP	23592263
MIRT455887	hsa-miR-4739	PAR-CLIP	23592263
MIRT455886	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT138451	hsa-miR-3675-3p	PAR-CLIP	23592263
MIRT138439	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT455885	hsa-miR-4330	PAR-CLIP	23592263
MIRT455884	hsa-miR-517-5p	PAR-CLIP	23592263
MIRT455883	hsa-miR-1251-5p	PAR-CLIP	23592263
MIRT138434	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT138455	hsa-miR-4645-3p	PAR-CLIP	23592263
MIRT138453	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT138448	hsa-miR-3162-5p	PAR-CLIP	23592263
MIRT455882	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT455881	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT1094541	hsa-miR-136	CLIP-seq
MIRT1094542	hsa-miR-146b-3p	CLIP-seq
MIRT1094543	hsa-miR-1915	CLIP-seq
MIRT1094544	hsa-miR-22	CLIP-seq
MIRT1094545	hsa-miR-2355-5p	CLIP-seq
MIRT1094546	hsa-miR-296-5p	CLIP-seq
MIRT1094547	hsa-miR-3134	CLIP-seq
MIRT1094548	hsa-miR-3173-5p	CLIP-seq
MIRT1094549	hsa-miR-3688-3p	CLIP-seq
MIRT1094550	hsa-miR-3978	CLIP-seq
MIRT1094551	hsa-miR-4270	CLIP-seq
MIRT1094552	hsa-miR-4292	CLIP-seq
MIRT1094553	hsa-miR-4300	CLIP-seq
MIRT1094554	hsa-miR-4441	CLIP-seq
MIRT1094555	hsa-miR-4534	CLIP-seq
MIRT1094556	hsa-miR-4640-3p	CLIP-seq
MIRT1094557	hsa-miR-4780	CLIP-seq
MIRT1094558	hsa-miR-874	CLIP-seq
MIRT1094559	hsa-miR-885-5p	CLIP-seq
MIRT1094560	hsa-miR-920	CLIP-seq
MIRT2025322	hsa-miR-4728-3p	CLIP-seq
MIRT1094542	hsa-miR-146b-3p	CLIP-seq
MIRT2256591	hsa-miR-148a	CLIP-seq
MIRT2256592	hsa-miR-148b	CLIP-seq
MIRT2256593	hsa-miR-152	CLIP-seq
MIRT2256594	hsa-miR-181a	CLIP-seq
MIRT2256595	hsa-miR-181b	CLIP-seq
MIRT2256596	hsa-miR-181c	CLIP-seq
MIRT2256597	hsa-miR-181d	CLIP-seq
MIRT1094544	hsa-miR-22	CLIP-seq
MIRT1094545	hsa-miR-2355-5p	CLIP-seq
MIRT1094548	hsa-miR-3173-5p	CLIP-seq
MIRT2256598	hsa-miR-3617	CLIP-seq
MIRT2256599	hsa-miR-4256	CLIP-seq
MIRT2256600	hsa-miR-4514	CLIP-seq
MIRT2256601	hsa-miR-455-3p	CLIP-seq
MIRT2256602	hsa-miR-4639-3p	CLIP-seq
MIRT1094556	hsa-miR-4640-3p	CLIP-seq
MIRT2256603	hsa-miR-4676-5p	CLIP-seq
MIRT2256604	hsa-miR-4692	CLIP-seq
MIRT2256605	hsa-miR-4714-5p	CLIP-seq
MIRT2256606	hsa-miR-548h	CLIP-seq
MIRT2256607	hsa-miR-548j	CLIP-seq
MIRT2256608	hsa-miR-575	CLIP-seq
MIRT2256609	hsa-miR-641	CLIP-seq
MIRT2256610	hsa-miR-668	CLIP-seq
MIRT1094558	hsa-miR-874	CLIP-seq
MIRT1094559	hsa-miR-885-5p	CLIP-seq
MIRT2389869	hsa-miR-658	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	23610368
E2F1	Repression	18440323
SP1	Activation	18440323

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000775	Component	Chromosome, centromeric region	IDA	14960279
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	14960279
GO:0000776	Component	Kinetochore	IDA	23891108
GO:0000776	Component	Kinetochore	IEA
GO:0003777	Function	Microtubule motor activity	IBA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0003777	Function	Microtubule motor activity	TAS	9434124
GO:0005515	Function	Protein binding	IPI	11092768, 19543227, 19632184, 21820309, 26496610, 27173435, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005819	Component	Spindle	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005871	Component	Kinesin complex	TAS	9434124
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0005881	Component	Cytoplasmic microtubule	ISS
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0007019	Process	Microtubule depolymerization	IDA	21820309
GO:0007019	Process	Microtubule depolymerization	IEA
GO:0007019	Process	Microtubule depolymerization	IMP	19060894
GO:0007019	Process	Microtubule depolymerization	TAS	26323690
GO:0007059	Process	Chromosome segregation	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	15843429
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0019237	Function	Centromeric DNA binding	TAS	9434124
GO:0030951	Process	Establishment or maintenance of microtubule cytoskeleton polarity	IMP	14718566
GO:0035371	Component	Microtubule plus-end	IDA	21820309, 23891108
GO:0035371	Component	Microtubule plus-end	TAS	26323690
GO:0051010	Function	Microtubule plus-end binding	IDA	19632184
GO:0051301	Process	Cell division	IEA
GO:0051310	Process	Metaphase chromosome alignment	IMP	23891108
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IMP	23891108
GO:0051983	Process	Regulation of chromosome segregation	IMP	19060894
GO:0098696	Process	Regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099188	Process	Postsynaptic cytoskeleton organization	IEA

Other IDs

• MIM: 604538
• HGNC: 6393
• e!Ensembl: ENSG00000142945

Protein

• UniProt ID: Q99661
• Protein name: Kinesin-like protein KIF2C (Kinesin-like protein 6) (Mitotic centromere-associated kinesin) (MCAK)
• Protein function: In complex with KIF18B, constitutes the major microtubule plus-end depolymerizing activity in mitotic cells (PubMed:21820309). Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis (PubM
• PDB: 2HEH, 4UBF, 4Y05, 5MIO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00225	Kinesin	264 → 588	Kinesin motor domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in thymus and testis, at low levels in small intestine, the mucosal lining of colon, and placenta, and at very low levels in spleen and ovary; expression is not detected in prostate, peripheral blood Leukocytes
• Sequence:

  MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDD
  VAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSEL
  RITAQENDMEVELPAAANSRKQFSVPPAPTRPSCPAVAEIPLRMVSEEMEEQVHSIRGSS
  SANPVNSVRRKSCLVKEVEKMKNKREEKKAQNSEMRMKRAQEYDSSFPNWEFARMIKEFR
  ATLECHPLTMTDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHEPKLKVDL
  TKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGG
  DLSGKAQNASKGIYAMASRDVFLLKNQPCYRKLGLEVYVTFFEIYNGKLFDLLNKKAKLR
  VLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSACRTSGQTFANSNSSRSHACFQIILRA
  KGRMHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFR
  ESKLTQVLRDSFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLI
  QMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGP
  DWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALRDVIKALRLAMQLEEQASRQISS
  KKRPQ

• Sequence length: 725

Pathways

KEGG:

Motor proteins

Reactome:

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
MHC class II antigen presentation
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
COPI-dependent Golgi-to-ER retrograde traffic
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
Kinesins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30883337		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17233835, 17944972, 30593585, 31073307		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17944972	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21679412, 23610368, 28754978, 30593585, 31285741, 34384030, 35456460, 37016301	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17944972	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28901309, 35915607, 36032071	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24240690		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28260099, 36793506, 37863123	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	18222353	Associate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	19879145, 27881713	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12124339		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18506187, 19937794, 23564489		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18506187		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18506187, 26148251	Associate	★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18222353, 20933357, 21435211		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18222353, 20933357, 21435211, 21810021		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18222353, 21435211	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18222353, 20933357, 21435211, 22192511, 28096762		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26151199		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21871624		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30474315	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21871624		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	30763715	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27563815, 37968758	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35387222	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22130050		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35387222	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	39201599	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	17944972	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	34591790	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	14749730	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31789390, 32831194	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17653072, 18506187, 35720323	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26148251, 27563815	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17233835, 17944972, 30593585, 31073307		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24240690		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17653072		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17653072, 19937794, 21165574, 22249213, 27146484, 31328811		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12124339		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18222353		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18222353	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19937794, 30883337, 31073307, 31328811, 31746663		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31328811		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34253236	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36029726	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	26283638	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	18506187	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22363599, 35720323, 37916740, 39201599	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33315534	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17653072		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17653072		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17653072, 24628949	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	17944972, 34591790	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	33025856	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32766313	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	37717078	Associate	★☆☆☆☆ Found in Text Mining only