SLC27A3 (solute carrier family 27 member 3)

Gene

• Entrez ID: 11000
• Gene name: Solute carrier family 27 member 3
• Gene symbol: SLC27A3
• Synonyms (NCBI Gene): ACSVL3, FATP3, VLCS-3
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene belongs to a family of integral membrane proteins and encodes a protein that is involved in lipid metabolism. The increased expression of this gene in human neural stem cells derived from induced pluripotent stem cells suggests that it plays an

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2106049	hsa-miR-2277-3p	CLIP-seq
MIRT2106050	hsa-miR-3660	CLIP-seq
MIRT2106051	hsa-miR-4526	CLIP-seq
MIRT2330386	hsa-miR-4712-5p	CLIP-seq
MIRT2330387	hsa-miR-770-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001676	Process	Long-chain fatty acid metabolic process	IBA
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	23936004
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IBA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IDA	23936004
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	23936004
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0015908	Process	Fatty acid transport	IEA
GO:0015908	Process	Fatty acid transport	IMP	32521232
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0031957	Function	Very long-chain fatty acid-CoA ligase activity	IDA	23936004
GO:0031957	Function	Very long-chain fatty acid-CoA ligase activity	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0047676	Function	Arachidonate-CoA ligase activity	IEA

Other IDs

• MIM: 604193
• HGNC: 10997
• e!Ensembl: ENSG00000143554

Protein

• UniProt ID: Q5K4L6
• Protein name: Long-chain fatty acid transport protein 3 (FATP-3) (Fatty acid transport protein 3) (Arachidonate--CoA ligase) (EC 6.2.1.15) (Long-chain-fatty-acid--CoA ligase) (EC 6.2.1.3) (Solute carrier family 27 member 3) (Very long-chain acyl-CoA synthetase homolog
• Protein function: Mainly functions as an acyl-CoA ligase catalyzing the ATP-dependent formation of fatty acyl-CoA using LCFA and very-long-chain fatty acids (VLCFA) as substrates (PubMed:23936004). Can mediate the levels of long-chain fatty acids (LCFA) in the ce
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00501	AMP-binding	161 → 551	AMP-binding enzyme	Family
  PF13193	AMP-binding_C	559 → 635	AMP-binding enzyme C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in bronchial and bronchiolar epithelial cells (at protein level). {ECO:0000269|PubMed:23936004}.
• Sequence:

  MAALLLLPLLLLLPLLLLKLHLWPQLRWLPADLAFAVRALCCKRALRARALAAAAADPEG
  PEGGCSLAWRLAELAQQRAAHTFLIHGSRRFSYSEAERESNRAARAFLRALGWDWGPDGG
  DSGEGSAGEGERAAPGAGDAAAGSGAEFAGGDGAARGGGAAAPLSPGATVALLLPAGPEF
  LWLWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGARALVLAPEFLESLEPDLPALRAMGL
  HLWAAGPGTHPAGISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARI
  SHLKILQCQGFYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQF
  WEDCQQHRVTVFQYIGELCRYLVNQPPSKAERGHKVRLAVGSGLRPDTWERFVRRFGPLQ
  VLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMAT
  SPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFRPGDVFFNTGDLLVCDDQGFLRF
  HDRTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGVTVPGHEGRAGMAALVLRPPHAL
  DLMQLYTHVSENLPPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSTLSDPLYVLDQ
  AVGAYLPLTTARYSALLAGNLRI

• Sequence length: 683

Pathways

KEGG:

Insulin resistance

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	34662886	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	26548558		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23936004, 25015569		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23936004, 24893952		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23936004, 24893952		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19920185, 30596429		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	34662886	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19920185		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23936004, 25015569		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24893952, 25015569		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19920185, 23936004, 24893952, 25015569		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35350787	Associate	★☆☆☆☆ Found in Text Mining only