SLC27A4 (solute carrier family 27 member 4)

Gene

• Entrez ID: 10999
• Gene name: Solute carrier family 27 member 4
• Gene symbol: SLC27A4
• Synonyms (NCBI Gene): ACSVL4, FATP4, IPS
• Chromosome: 9
• Chromosome location: 9q34.11
• Summary: This gene encodes a member of a family of fatty acid transport proteins, which are involved in translocation of long-chain fatty acids cross the plasma membrane. This protein is expressed at high levels on the apical side of mature enterocytes in the smal

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853131	C>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs137853132	G>A	Pathogenic	Coding sequence variant, missense variant
rs137853133	T>C	Pathogenic	Coding sequence variant, missense variant
rs137853134	A>G	Pathogenic	Coding sequence variant, missense variant
rs137853135	G>A	Pathogenic	Coding sequence variant, missense variant
rs368207076	T>G	Pathogenic	Splice donor variant
rs758657421	AG>-	Pathogenic	Coding sequence variant, frameshift variant
rs764922350	A>G	Pathogenic	Splice acceptor variant
rs765311079	C>G,T	Likely-pathogenic	Coding sequence variant, missense variant
rs869312967	G>A	Pathogenic	Coding sequence variant, missense variant
rs1340721389	C>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1588559786	G>A	Pathogenic	Splice acceptor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023551	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT031405	hsa-miR-16-5p	Proteomics	18668040
MIRT050385	hsa-miR-23a-3p	CLASH	23622248
MIRT653664	hsa-miR-4798-3p	HITS-CLIP	23824327
MIRT653663	hsa-miR-3680-5p	HITS-CLIP	23824327
MIRT653662	hsa-miR-6729-3p	HITS-CLIP	23824327
MIRT653661	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT653660	hsa-miR-3183	HITS-CLIP	23824327
MIRT653659	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT653658	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT653657	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT653656	hsa-miR-6511a-3p	HITS-CLIP	23824327
MIRT653655	hsa-miR-6511b-3p	HITS-CLIP	23824327
MIRT653654	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT653653	hsa-miR-518c-5p	HITS-CLIP	23824327
MIRT653652	hsa-miR-326	HITS-CLIP	23824327
MIRT653651	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT653650	hsa-miR-6764-3p	HITS-CLIP	23824327
MIRT653649	hsa-miR-6824-3p	HITS-CLIP	23824327
MIRT653648	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT653647	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT653646	hsa-miR-3977	HITS-CLIP	23824327
MIRT653645	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT518188	hsa-miR-552-3p	PAR-CLIP	23446348
MIRT518187	hsa-miR-764	PAR-CLIP	23446348
MIRT518186	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT518185	hsa-miR-7155-5p	PAR-CLIP	23446348
MIRT518184	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT518182	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT518183	hsa-miR-5095	PAR-CLIP	23446348
MIRT518181	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT518180	hsa-miR-3170	PAR-CLIP	23446348
MIRT518179	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT653664	hsa-miR-4798-3p	HITS-CLIP	23824327
MIRT653663	hsa-miR-3680-5p	HITS-CLIP	23824327
MIRT653662	hsa-miR-6729-3p	HITS-CLIP	23824327
MIRT653661	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT653660	hsa-miR-3183	HITS-CLIP	23824327
MIRT653659	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT653658	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT653657	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT653656	hsa-miR-6511a-3p	HITS-CLIP	23824327
MIRT653655	hsa-miR-6511b-3p	HITS-CLIP	23824327
MIRT653654	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT653653	hsa-miR-518c-5p	HITS-CLIP	23824327
MIRT653652	hsa-miR-326	HITS-CLIP	23824327
MIRT653651	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT653650	hsa-miR-6764-3p	HITS-CLIP	23824327
MIRT653649	hsa-miR-6824-3p	HITS-CLIP	23824327
MIRT653648	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT653647	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT653646	hsa-miR-3977	HITS-CLIP	23824327
MIRT653645	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT518188	hsa-miR-552-3p	PAR-CLIP	23446348
MIRT518187	hsa-miR-764	PAR-CLIP	23446348
MIRT518186	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT518185	hsa-miR-7155-5p	PAR-CLIP	23446348
MIRT518184	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT518182	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT518183	hsa-miR-5095	PAR-CLIP	23446348
MIRT518181	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT518180	hsa-miR-3170	PAR-CLIP	23446348
MIRT518179	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT1358041	hsa-miR-1207-5p	CLIP-seq
MIRT1358042	hsa-miR-1268	CLIP-seq
MIRT1358043	hsa-miR-1268b	CLIP-seq
MIRT1358044	hsa-miR-1275	CLIP-seq
MIRT1358045	hsa-miR-1321	CLIP-seq
MIRT1358046	hsa-miR-1909	CLIP-seq
MIRT1358047	hsa-miR-1913	CLIP-seq
MIRT1358048	hsa-miR-1915	CLIP-seq
MIRT1358049	hsa-miR-1976	CLIP-seq
MIRT1358050	hsa-miR-2392	CLIP-seq
MIRT1358051	hsa-miR-3192	CLIP-seq
MIRT1358052	hsa-miR-3202	CLIP-seq
MIRT1358053	hsa-miR-324-3p	CLIP-seq
MIRT1358054	hsa-miR-3605-5p	CLIP-seq
MIRT1358055	hsa-miR-370	CLIP-seq
MIRT1358056	hsa-miR-4270	CLIP-seq
MIRT1358057	hsa-miR-4313	CLIP-seq
MIRT1358058	hsa-miR-4314	CLIP-seq
MIRT1358059	hsa-miR-4441	CLIP-seq
MIRT1358060	hsa-miR-4443	CLIP-seq
MIRT1358061	hsa-miR-4525	CLIP-seq
MIRT1358062	hsa-miR-4646-5p	CLIP-seq
MIRT1358063	hsa-miR-4665-5p	CLIP-seq
MIRT1358064	hsa-miR-4707-5p	CLIP-seq
MIRT1358065	hsa-miR-4711-5p	CLIP-seq
MIRT1358066	hsa-miR-4717-3p	CLIP-seq
MIRT1358067	hsa-miR-4718	CLIP-seq
MIRT1358068	hsa-miR-4723-5p	CLIP-seq
MIRT1358069	hsa-miR-4739	CLIP-seq
MIRT1358070	hsa-miR-4747-5p	CLIP-seq
MIRT1358071	hsa-miR-4756-5p	CLIP-seq
MIRT1358072	hsa-miR-4763-3p	CLIP-seq
MIRT1358073	hsa-miR-625	CLIP-seq
MIRT1358074	hsa-miR-634	CLIP-seq
MIRT1358075	hsa-miR-765	CLIP-seq
MIRT1358076	hsa-miR-940	CLIP-seq
MIRT2106052	hsa-miR-103b	CLIP-seq
MIRT2106053	hsa-miR-1193	CLIP-seq
MIRT2106054	hsa-miR-1225-3p	CLIP-seq
MIRT2106055	hsa-miR-1233	CLIP-seq
MIRT2106056	hsa-miR-1262	CLIP-seq
MIRT2106057	hsa-miR-1293	CLIP-seq
MIRT2106058	hsa-miR-150	CLIP-seq
MIRT1358050	hsa-miR-2392	CLIP-seq
MIRT2106059	hsa-miR-2861	CLIP-seq
MIRT2106060	hsa-miR-296-3p	CLIP-seq
MIRT2106061	hsa-miR-3065-3p	CLIP-seq
MIRT2106062	hsa-miR-3184	CLIP-seq
MIRT2106063	hsa-miR-3194-3p	CLIP-seq
MIRT1358052	hsa-miR-3202	CLIP-seq
MIRT2106064	hsa-miR-328	CLIP-seq
MIRT2106065	hsa-miR-34a	CLIP-seq
MIRT2106066	hsa-miR-34c-5p	CLIP-seq
MIRT2106067	hsa-miR-3614-5p	CLIP-seq
MIRT2106068	hsa-miR-3664-3p	CLIP-seq
MIRT2106069	hsa-miR-3689d	CLIP-seq
MIRT2106070	hsa-miR-3690	CLIP-seq
MIRT2106071	hsa-miR-3909	CLIP-seq
MIRT2106072	hsa-miR-3943	CLIP-seq
MIRT2106073	hsa-miR-423-5p	CLIP-seq
MIRT2106074	hsa-miR-4254	CLIP-seq
MIRT2106075	hsa-miR-4279	CLIP-seq
MIRT2106076	hsa-miR-4283	CLIP-seq
MIRT1358057	hsa-miR-4313	CLIP-seq
MIRT2106077	hsa-miR-4324	CLIP-seq
MIRT2106078	hsa-miR-4328	CLIP-seq
MIRT2106079	hsa-miR-4417	CLIP-seq
MIRT2106080	hsa-miR-4425	CLIP-seq
MIRT2106081	hsa-miR-4438	CLIP-seq
MIRT2106082	hsa-miR-4447	CLIP-seq
MIRT2106083	hsa-miR-4472	CLIP-seq
MIRT2106084	hsa-miR-4483	CLIP-seq
MIRT2106085	hsa-miR-449a	CLIP-seq
MIRT2106086	hsa-miR-449b	CLIP-seq
MIRT2106087	hsa-miR-4512	CLIP-seq
MIRT2106088	hsa-miR-4533	CLIP-seq
MIRT2106089	hsa-miR-4534	CLIP-seq
MIRT2106090	hsa-miR-4667-3p	CLIP-seq
MIRT2106091	hsa-miR-4667-5p	CLIP-seq
MIRT2106092	hsa-miR-4676-5p	CLIP-seq
MIRT2106093	hsa-miR-4688	CLIP-seq
MIRT2106094	hsa-miR-4690-3p	CLIP-seq
MIRT2106095	hsa-miR-4691-5p	CLIP-seq
MIRT2106096	hsa-miR-4700-5p	CLIP-seq
MIRT2106097	hsa-miR-4701-3p	CLIP-seq
MIRT1358065	hsa-miR-4711-5p	CLIP-seq
MIRT2106098	hsa-miR-4713-5p	CLIP-seq
MIRT2106099	hsa-miR-4729	CLIP-seq
MIRT1358070	hsa-miR-4747-5p	CLIP-seq
MIRT2106100	hsa-miR-4763-5p	CLIP-seq
MIRT2106101	hsa-miR-4802-5p	CLIP-seq
MIRT2106102	hsa-miR-486-3p	CLIP-seq
MIRT2106103	hsa-miR-507	CLIP-seq
MIRT2106104	hsa-miR-532-3p	CLIP-seq
MIRT2106105	hsa-miR-541	CLIP-seq
MIRT2106106	hsa-miR-544b	CLIP-seq
MIRT2106107	hsa-miR-557	CLIP-seq
MIRT2106108	hsa-miR-575	CLIP-seq
MIRT2106109	hsa-miR-617	CLIP-seq
MIRT2106110	hsa-miR-637	CLIP-seq
MIRT2106111	hsa-miR-654-5p	CLIP-seq
MIRT2106112	hsa-miR-767-3p	CLIP-seq
MIRT2106113	hsa-miR-876-3p	CLIP-seq
MIRT2106053	hsa-miR-1193	CLIP-seq
MIRT2330388	hsa-miR-1200	CLIP-seq
MIRT2330389	hsa-miR-1267	CLIP-seq
MIRT2330390	hsa-miR-1292	CLIP-seq
MIRT1358050	hsa-miR-2392	CLIP-seq
MIRT2106059	hsa-miR-2861	CLIP-seq
MIRT2106061	hsa-miR-3065-3p	CLIP-seq
MIRT2330391	hsa-miR-3144-5p	CLIP-seq
MIRT2106062	hsa-miR-3184	CLIP-seq
MIRT2330392	hsa-miR-3191	CLIP-seq
MIRT2106063	hsa-miR-3194-3p	CLIP-seq
MIRT2106065	hsa-miR-34a	CLIP-seq
MIRT2106066	hsa-miR-34c-5p	CLIP-seq
MIRT2106067	hsa-miR-3614-5p	CLIP-seq
MIRT2106068	hsa-miR-3664-3p	CLIP-seq
MIRT2330393	hsa-miR-3664-5p	CLIP-seq
MIRT2106071	hsa-miR-3909	CLIP-seq
MIRT2106073	hsa-miR-423-5p	CLIP-seq
MIRT2106077	hsa-miR-4324	CLIP-seq
MIRT2106078	hsa-miR-4328	CLIP-seq
MIRT2330394	hsa-miR-4471	CLIP-seq
MIRT2106085	hsa-miR-449a	CLIP-seq
MIRT2106086	hsa-miR-449b	CLIP-seq
MIRT2106087	hsa-miR-4512	CLIP-seq
MIRT2330395	hsa-miR-4520a-3p	CLIP-seq
MIRT2330396	hsa-miR-4520b-3p	CLIP-seq
MIRT2106089	hsa-miR-4534	CLIP-seq
MIRT1358062	hsa-miR-4646-5p	CLIP-seq
MIRT2330397	hsa-miR-4652-5p	CLIP-seq
MIRT2106091	hsa-miR-4667-5p	CLIP-seq
MIRT2106093	hsa-miR-4688	CLIP-seq
MIRT2106094	hsa-miR-4690-3p	CLIP-seq
MIRT2106096	hsa-miR-4700-5p	CLIP-seq
MIRT2106099	hsa-miR-4729	CLIP-seq
MIRT2106100	hsa-miR-4763-5p	CLIP-seq
MIRT2106101	hsa-miR-4802-5p	CLIP-seq
MIRT2106102	hsa-miR-486-3p	CLIP-seq
MIRT2106106	hsa-miR-544b	CLIP-seq
MIRT2106109	hsa-miR-617	CLIP-seq
MIRT2330398	hsa-miR-622	CLIP-seq
MIRT2330399	hsa-miR-627	CLIP-seq
MIRT2106110	hsa-miR-637	CLIP-seq
MIRT2330400	hsa-miR-661	CLIP-seq
MIRT2106112	hsa-miR-767-3p	CLIP-seq
MIRT2330401	hsa-miR-890	CLIP-seq
MIRT2330402	hsa-miR-924	CLIP-seq
MIRT2330388	hsa-miR-1200	CLIP-seq
MIRT1358042	hsa-miR-1268	CLIP-seq
MIRT1358043	hsa-miR-1268b	CLIP-seq
MIRT1358044	hsa-miR-1275	CLIP-seq
MIRT2624450	hsa-miR-1291	CLIP-seq
MIRT1358045	hsa-miR-1321	CLIP-seq
MIRT1358048	hsa-miR-1915	CLIP-seq
MIRT2624451	hsa-miR-2355-3p	CLIP-seq
MIRT1358050	hsa-miR-2392	CLIP-seq
MIRT2624452	hsa-miR-3126-5p	CLIP-seq
MIRT2624453	hsa-miR-3150a-3p	CLIP-seq
MIRT2624454	hsa-miR-3162-3p	CLIP-seq
MIRT2624455	hsa-miR-3169	CLIP-seq
MIRT2624456	hsa-miR-3173-5p	CLIP-seq
MIRT2624457	hsa-miR-3175	CLIP-seq
MIRT1358054	hsa-miR-3605-5p	CLIP-seq
MIRT2624458	hsa-miR-3617	CLIP-seq
MIRT2106071	hsa-miR-3909	CLIP-seq
MIRT2624459	hsa-miR-3913-3p	CLIP-seq
MIRT2624460	hsa-miR-4251	CLIP-seq
MIRT2624461	hsa-miR-4269	CLIP-seq
MIRT1358056	hsa-miR-4270	CLIP-seq
MIRT2624462	hsa-miR-4287	CLIP-seq
MIRT2106077	hsa-miR-4324	CLIP-seq
MIRT2624463	hsa-miR-4419a	CLIP-seq
MIRT1358059	hsa-miR-4441	CLIP-seq
MIRT2624464	hsa-miR-4457	CLIP-seq
MIRT2624465	hsa-miR-4469	CLIP-seq
MIRT2624466	hsa-miR-4481	CLIP-seq
MIRT2624467	hsa-miR-4510	CLIP-seq
MIRT2624468	hsa-miR-4514	CLIP-seq
MIRT1358061	hsa-miR-4525	CLIP-seq
MIRT1358063	hsa-miR-4665-5p	CLIP-seq
MIRT2624469	hsa-miR-4685-3p	CLIP-seq
MIRT2624470	hsa-miR-4691-3p	CLIP-seq
MIRT2624471	hsa-miR-4692	CLIP-seq
MIRT1358068	hsa-miR-4723-5p	CLIP-seq
MIRT1358069	hsa-miR-4739	CLIP-seq
MIRT2624472	hsa-miR-4740-5p	CLIP-seq
MIRT2624473	hsa-miR-4742-5p	CLIP-seq
MIRT2624474	hsa-miR-4745-5p	CLIP-seq
MIRT1358071	hsa-miR-4756-5p	CLIP-seq
MIRT2624475	hsa-miR-4793-5p	CLIP-seq
MIRT2624476	hsa-miR-491-5p	CLIP-seq
MIRT2624477	hsa-miR-539	CLIP-seq
MIRT2106106	hsa-miR-544b	CLIP-seq
MIRT1358073	hsa-miR-625	CLIP-seq
MIRT2624478	hsa-miR-641	CLIP-seq
MIRT2624479	hsa-miR-676	CLIP-seq
MIRT1358075	hsa-miR-765	CLIP-seq
MIRT2624480	hsa-miR-939	CLIP-seq
MIRT1358044	hsa-miR-1275	CLIP-seq
MIRT2624450	hsa-miR-1291	CLIP-seq
MIRT1358045	hsa-miR-1321	CLIP-seq
MIRT1358048	hsa-miR-1915	CLIP-seq
MIRT1358050	hsa-miR-2392	CLIP-seq
MIRT2624452	hsa-miR-3126-5p	CLIP-seq
MIRT2624455	hsa-miR-3169	CLIP-seq
MIRT2624456	hsa-miR-3173-5p	CLIP-seq
MIRT1358054	hsa-miR-3605-5p	CLIP-seq
MIRT2624461	hsa-miR-4269	CLIP-seq
MIRT1358056	hsa-miR-4270	CLIP-seq
MIRT2624463	hsa-miR-4419a	CLIP-seq
MIRT1358059	hsa-miR-4441	CLIP-seq
MIRT2624464	hsa-miR-4457	CLIP-seq
MIRT2624466	hsa-miR-4481	CLIP-seq
MIRT2624467	hsa-miR-4510	CLIP-seq
MIRT2624468	hsa-miR-4514	CLIP-seq
MIRT1358061	hsa-miR-4525	CLIP-seq
MIRT1358063	hsa-miR-4665-5p	CLIP-seq
MIRT2624470	hsa-miR-4691-3p	CLIP-seq
MIRT2624471	hsa-miR-4692	CLIP-seq
MIRT1358068	hsa-miR-4723-5p	CLIP-seq
MIRT1358069	hsa-miR-4739	CLIP-seq
MIRT2624472	hsa-miR-4740-5p	CLIP-seq
MIRT2624473	hsa-miR-4742-5p	CLIP-seq
MIRT2624474	hsa-miR-4745-5p	CLIP-seq
MIRT1358071	hsa-miR-4756-5p	CLIP-seq
MIRT2106106	hsa-miR-544b	CLIP-seq
MIRT1358073	hsa-miR-625	CLIP-seq
MIRT1358075	hsa-miR-765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000038	Process	Very long-chain fatty acid metabolic process	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001579	Process	Medium-chain fatty acid transport	IBA
GO:0001579	Process	Medium-chain fatty acid transport	IEA
GO:0001676	Process	Long-chain fatty acid metabolic process	IBA
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	22022213
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IDA	22022213
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IEA
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IBA
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IEA
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IMP	21395585
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005783	Component	Endoplasmic reticulum	IDA	32521232
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	22022213, 25603556
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IDA	25603556
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0015245	Function	Fatty acid transmembrane transporter activity	TAS
GO:0015908	Process	Fatty acid transport	IMP	32521232
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0015909	Process	Long-chain fatty acid transport	IMP	21395585
GO:0015909	Process	Long-chain fatty acid transport	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0031526	Component	Brush border membrane	IEA
GO:0031957	Function	Very long-chain fatty acid-CoA ligase activity	IEA
GO:0042760	Process	Very long-chain fatty acid catabolic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	25603556
GO:0043588	Process	Skin development	IEA
GO:0044381	Process	Glucose import in response to insulin stimulus	IEA
GO:0044381	Process	Glucose import in response to insulin stimulus	ISS
GO:0044539	Process	Long-chain fatty acid import into cell	IBA
GO:0044539	Process	Long-chain fatty acid import into cell	IDA	22022213
GO:0044539	Process	Long-chain fatty acid import into cell	IEA
GO:0044539	Process	Long-chain fatty acid import into cell	ISS	24503477
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IDA	25603556
GO:0047676	Function	Arachidonate-CoA ligase activity	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0090433	Function	Palmitoyl-CoA ligase activity	IDA	25603556
GO:0090434	Function	Oleoyl-CoA ligase activity	IBA
GO:0090434	Function	Oleoyl-CoA ligase activity	IDA	25603556
GO:0090434	Function	Oleoyl-CoA ligase activity	IEA
GO:0090434	Function	Oleoyl-CoA ligase activity	ISS
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1990379	Process	Lipid transport across blood-brain barrier	IEA
GO:1990379	Process	Lipid transport across blood-brain barrier	IMP	21395585

Other IDs

• MIM: 604194
• HGNC: 10998
• e!Ensembl: ENSG00000167114

Protein

• UniProt ID: Q6P1M0
• Protein name: Long-chain fatty acid transport protein 4 (FATP-4) (Fatty acid transport protein 4) (Arachidonate--CoA ligase) (EC 6.2.1.15) (Long-chain-fatty-acid--CoA ligase) (EC 6.2.1.3) (Solute carrier family 27 member 4) (Very long-chain acyl-CoA synthetase 4) (ACSV
• Protein function: Mediates the levels of long-chain fatty acids (LCFA) in the cell by facilitating their transport across cell membranes (PubMed:10518211, PubMed:12556534, PubMed:20448275, PubMed:21395585, PubMed:22022213). Appears to be the principal fatty acid
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00501	AMP-binding	80 → 512	AMP-binding enzyme	Family
  PF13193	AMP-binding_C	520 → 595	AMP-binding enzyme C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at highest levels in brain, testis, colon and kidney. Expressed at medium levels in heart and liver, small intestine and stomach. Expressed at low levels in peripheral leukocytes, bone marrow, skeletal muscle and aorta. Expre
• Sequence:

  MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL
  KVKAKVRQCLQERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQA
  RGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFG
  SEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDK
  LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQ
  CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALG
  NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR
  VNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKK
  GDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVE
  VPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTE
  LRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL

• Sequence length: 643

Pathways

KEGG:

PPAR signaling pathway
Insulin resistance
Fat digestion and absorption

Reactome:

Defective SLC27A4 causes ichthyosis prematurity syndrome (IPS)
Transport of fatty acids

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal recessive congenital ichthyosis	Likely pathogenic; Pathogenic	rs137853131	RCV001729337	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ichthyosis prematurity syndrome	Pathogenic; Likely pathogenic	rs2131266064, rs764219842, rs746178942, rs2131265398, rs587776384, rs777972512, rs137853131, rs1588559786, rs137853132, rs137853134, rs764922350, rs147688821, rs142366975, rs1454874748, rs2539457972, rs2539458072, rs765311079, rs758657421, rs1340721389, rs776594920	RCV001523894 RCV001523895 RCV001523896 RCV001523897 RCV005042282 RCV002246710 RCV000006098 RCV000006099 RCV000006100 RCV000006102 RCV000006103 RCV005050657 RCV005047688 RCV003985904 RCV003985977 RCV004594804 RCV000988258 RCV000988259 RCV005047181 RCV001257453	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Lamellar ichthyosis	Likely pathogenic; Pathogenic	rs587776384, rs2131249868, rs1832802732, rs137853134, rs1454874748	RCV002265622 RCV002266409 RCV002510421 RCV003398450 RCV005407195	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC27A4-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29290585		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	30579722		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28539639		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26548558		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	26548558		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30388870		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30388870	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	28539639		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22022213	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26662804		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36875456	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23307247		★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	23226340, 23290633, 26506231		★☆☆☆☆ Found in Text Mining only
Congenital Nonbullous Ichthyosiform Erythroderma	Congenital Nonbullous Ichthyosiform Erythroderma	BEFREE	23226340, 23290633		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31089396		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	27802123, 30849010		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25131691		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	15897383		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28846666	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36875456	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17825092	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17825092, 22308265		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25131691		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31526678		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	26932421		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25114062	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30579722		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30497809		★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	23226340, 26506231		★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ichthyosiform Erythroderma, Congenital	Ichthyosis Congenita	BEFREE	23226340, 23290633		★☆☆☆☆ Found in Text Mining only
ICHTHYOSIS PREMATURITY SYNDROME	ICHTHYOSIS PREMATURITY SYNDROME	BEFREE	19631310, 23226340, 23271751, 23290633, 24120574, 29605190, 30497809, 31519952, 31595490		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ICHTHYOSIS PREMATURITY SYNDROME	ICHTHYOSIS PREMATURITY SYNDROME	UNIPROT_DG	19631310, 20815031		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ICHTHYOSIS PREMATURITY SYNDROME	ICHTHYOSIS PREMATURITY SYNDROME	ORPHANET_DG	19631310		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ICHTHYOSIS PREMATURITY SYNDROME	ICHTHYOSIS PREMATURITY SYNDROME	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ICHTHYOSIS PREMATURITY SYNDROME	ICHTHYOSIS PREMATURITY SYNDROME	GENOMICS_ENGLAND_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ICHTHYOSIS PREMATURITY SYNDROME	ICHTHYOSIS PREMATURITY SYNDROME	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ichthyosis-prematurity syndrome	Ichthyosis-Prematurity Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	26662804		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26662804	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30388870		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26662804		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30388870		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28216782, 28981832		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	14715877		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23307247, 31089396		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28614036		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15168018		★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	35563741	Stimulate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29290585		★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	28539639		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25603556		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25611071		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	26932421		★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	37466160	Associate	★☆☆☆☆ Found in Text Mining only