SDS (serine dehydratase)

Gene

• Entrez ID: 10993
• Gene name: Serine dehydratase
• Gene symbol: SDS
• Synonyms (NCBI Gene): SDH, hSDH
• Chromosome: 12
• Chromosome location: 12q24.13
• Summary: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2098155	hsa-miR-2278	CLIP-seq
MIRT2098156	hsa-miR-2392	CLIP-seq
MIRT2098157	hsa-miR-377	CLIP-seq
MIRT2098158	hsa-miR-4274	CLIP-seq
MIRT2098159	hsa-miR-4704-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003941	Function	L-serine ammonia-lyase activity	IBA
GO:0003941	Function	L-serine ammonia-lyase activity	IDA	15618015, 15689518, 16580895, 18342636
GO:0003941	Function	L-serine ammonia-lyase activity	IEA
GO:0004794	Function	Threonine deaminase activity	IDA	15618015, 16580895
GO:0004794	Function	Threonine deaminase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006520	Process	Amino acid metabolic process	IEA
GO:0006565	Process	L-serine catabolic process	IBA
GO:0006565	Process	L-serine catabolic process	IDA	15689518, 18342636
GO:0006629	Process	Lipid metabolic process	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IDA	15689518
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IMP	16580895
GO:0042803	Function	Protein homodimerization activity	IDA	15689518
GO:0042866	Process	Pyruvate biosynthetic process	IDA	15689518
GO:0044283	Process	Small molecule biosynthetic process	IEA

Other IDs

• MIM: 182128
• HGNC: 10691
• e!Ensembl: ENSG00000135094

Protein

• UniProt ID: P20132
• Protein name: L-serine dehydratase/L-threonine deaminase (SDH) (EC 4.3.1.17) (Hepatic serine dehydratase) (hSDH) (L-serine deaminase) (L-threonine dehydratase) (TDH) (EC 4.3.1.19)
• Protein function: Catalyzes the pyridoxal-phosphate-dependent dehydrative deamination of L-threonine and L-serine to ammonia and alpha-ketobutyrate and pyruvate, respectively. {ECO:0000269|PubMed:15618015, ECO:0000269|PubMed:15689518, ECO:0000269|PubMed:16580895,
• PDB: 1P5J, 4H27
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00291	PALP	5 → 304	Pyridoxal-phosphate dependent enzyme	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in the perivenous regions of the liver. {ECO:0000269|PubMed:15618015}.
• Sequence:

  MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHF
  VCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA
  KALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGL
  QEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHP
  IFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVV
  IVCGGSNISLAQLRALKEQLGMTNRLPK

• Sequence length: 328

Pathways

KEGG:

Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids

Reactome:

Threonine catabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations