SLC38A3 (solute carrier family 38 member 3)

Gene

• Entrez ID: 10991
• Gene name: Solute carrier family 38 member 3
• Gene symbol: SLC38A3
• Synonyms (NCBI Gene): DEE102, G17, NAT1, SN1, SNAT3
• Chromosome: 3
• Chromosome location: 3p21.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1363005	hsa-miR-143	CLIP-seq
MIRT1363006	hsa-miR-1915	CLIP-seq
MIRT1363007	hsa-miR-4685-5p	CLIP-seq
MIRT1363008	hsa-miR-4770	CLIP-seq
MIRT2107651	hsa-miR-1275	CLIP-seq
MIRT1363005	hsa-miR-143	CLIP-seq
MIRT2107652	hsa-miR-3175	CLIP-seq
MIRT2107653	hsa-miR-4525	CLIP-seq
MIRT2107654	hsa-miR-4656	CLIP-seq
MIRT2107655	hsa-miR-4665-5p	CLIP-seq
MIRT2107656	hsa-miR-4723-5p	CLIP-seq
MIRT2107657	hsa-miR-4731-5p	CLIP-seq
MIRT1363008	hsa-miR-4770	CLIP-seq
MIRT2107658	hsa-miR-625	CLIP-seq
MIRT2107659	hsa-miR-637	CLIP-seq
MIRT2331487	hsa-miR-214	CLIP-seq
MIRT2331488	hsa-miR-3619-5p	CLIP-seq
MIRT2331489	hsa-miR-4291	CLIP-seq
MIRT2331490	hsa-miR-4758-3p	CLIP-seq
MIRT2331491	hsa-miR-761	CLIP-seq
MIRT2331492	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003333	Process	Amino acid transmembrane transport	IBA
GO:0005290	Function	L-histidine transmembrane transporter activity	IBA
GO:0005290	Function	L-histidine transmembrane transporter activity	IDA	10823827
GO:0005290	Function	L-histidine transmembrane transporter activity	IEA
GO:0005295	Function	Neutral L-amino acid:sodium symporter activity	IEA
GO:0005295	Function	Neutral L-amino acid:sodium symporter activity	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006865	Process	Amino acid transport	IEA
GO:0006865	Process	Amino acid transport	TAS
GO:0006867	Process	Asparagine transport	IBA
GO:0006867	Process	Asparagine transport	IDA	10823827
GO:0006867	Process	Asparagine transport	IEA
GO:0006868	Process	Glutamine transport	IBA
GO:0006868	Process	Glutamine transport	IDA	10823827
GO:0006868	Process	Glutamine transport	IEA
GO:0006868	Process	Glutamine transport	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0010585	Process	Glutamine secretion	IEA
GO:0010585	Process	Glutamine secretion	ISS
GO:0015171	Function	Amino acid transmembrane transporter activity	TAS
GO:0015180	Function	L-alanine transmembrane transporter activity	IDA	10823827
GO:0015182	Function	L-asparagine transmembrane transporter activity	IBA
GO:0015182	Function	L-asparagine transmembrane transporter activity	IDA	10823827
GO:0015182	Function	L-asparagine transmembrane transporter activity	IEA
GO:0015186	Function	L-glutamine transmembrane transporter activity	IBA
GO:0015186	Function	L-glutamine transmembrane transporter activity	IDA	10823827
GO:0015186	Function	L-glutamine transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015297	Function	Antiporter activity	IEA
GO:0015808	Process	L-alanine transport	IDA	10823827
GO:0015817	Process	Histidine transport	IBA
GO:0015817	Process	Histidine transport	IDA	10823827
GO:0015817	Process	Histidine transport	IEA
GO:0015817	Process	Histidine transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051365	Process	Cellular response to potassium ion starvation	IEA
GO:0080144	Process	Intracellular amino acid homeostasis	IEA
GO:0080144	Process	Intracellular amino acid homeostasis	ISS
GO:0140830	Function	L-glutamine, sodium:proton antiporter activity	IEA
GO:0140830	Function	L-glutamine, sodium:proton antiporter activity	ISS
GO:0140831	Function	L-asparagine, sodium:proton antiporter activity	IEA
GO:0140831	Function	L-asparagine, sodium:proton antiporter activity	ISS
GO:0140832	Function	L-histidine, sodium:proton antiporter activity	IEA
GO:0140832	Function	L-histidine, sodium:proton antiporter activity	ISS
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1902024	Process	L-histidine transport	IEA
GO:1902024	Process	L-histidine transport	ISS
GO:1903803	Process	L-glutamine import across plasma membrane	IEA
GO:1903803	Process	L-glutamine import across plasma membrane	ISS
GO:1903810	Process	L-histidine import across plasma membrane	IEA
GO:1903810	Process	L-histidine import across plasma membrane	ISS
GO:1903811	Process	L-asparagine import across plasma membrane	IEA
GO:1903811	Process	L-asparagine import across plasma membrane	ISS
GO:2000487	Process	Positive regulation of glutamine transport	IEA

Other IDs

• MIM: 604437
• HGNC: 18044
• e!Ensembl: ENSG00000188338

Protein

• UniProt ID: Q99624
• Protein name: Sodium-coupled neutral amino acid transporter 3 (N-system amino acid transporter 1) (Na(+)-coupled neutral amino acid transporter 3) (Solute carrier family 38 member 3) (System N amino acid transporter 1)
• Protein function: Symporter that cotransports specific neutral amino acids and sodium ions, coupled to an H(+) antiporter activity (PubMed:10823827). Mainly participates in the glutamate-GABA-glutamine cycle in brain where it transports L-glutamine from astrocyte
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01490	Aa_trans	64 → 491	Transmembrane amino acid transporter protein	Family

• Sequence:

  MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFT
  DFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTAVALLSSYSIHLLLKS
  SGVVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYLYIIKSELPLVIQTFLNLEE
  KTSDWYMNGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSCMVFFLIAVIYKKFHVPC
  PLPPNFNNTTGNFSHVEIVKEKVQLQVEPEASAFCTPSYFTLNSQTAYTIPIMAFAFVCH
  PEVLPIYTELKDPSKKKMQHISNLSIAVMYIMYFLAALFGYLTFYNGVESELLHTYSKVD
  PFDVLILCVRVAVLTAVTLTVPIVLFPVRRAIQQMLFPNQEFSWLRHVLIAVGLLTCINL
  LVIFAPNILGIFGVIGATSAPFLIFIFPAIFYFRIMPTEKEPARSTPKILALCFAMLGFL
  LMTMSLSFIIIDWASGTSRHGGNH

• Sequence length: 504

Pathways

KEGG:

Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation

Reactome:

Amino acid transport across the plasma membrane

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Developmental and epileptic encephalopathy 102	Likely pathogenic; Pathogenic	rs2109159077, rs2109157808, rs1368316485, rs2109158868, rs2109158872, rs1437118005	RCV002250376 RCV002250384 RCV002250385 RCV002250386 RCV002250387 RCV003152963	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CANNABIS DEPENDENCE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALISED EPILEPSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC EARLY-ONSET EPILEPTIC ENCEPHALOPATHY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Short stature	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10868688, 29214875		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	18491231		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11266080		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12485520		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	21347396		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	10585581		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15987714		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16981843, 8895478		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	11875368, 22905173, 8895478, 9682272		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	14724163		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10868688, 29214875		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	19663877		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15142281	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	25413361, 28912853		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	16513216		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11927838		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	11927838		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26641831, 31809667	Associate	★☆☆☆☆ Found in Text Mining only
Asthma, Occupational	Asthma	BEFREE	18680475		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	11505221		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10022251, 10398432, 10507782, 10868698, 11323185, 11431340, 12376500, 15011747, 15197537, 15725609, 16003747, 16955540, 17026750, 17675654, 18544563, 21678399, 23569127, 26681036, 28604993, 28696911, 8597119, 9107426, 9721868		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	16003747		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16959263, 18365755		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	34605855	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10090301, 10698485, 11291049, 12835615, 12860276, 14517345, 15084249, 15090724, 15226672, 16049806, 17010218, 17973251, 18288399, 24467436, 25528056, 27648926, 28359264, 29315819, 29339455, 29901116, 29964355, 29969986, 31358821, 9610785		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15084249, 26965286, 29315819, 29339455, 29901116, 29969986, 31910058, 32555504, 33176066, 35906899, 37107601	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29964355	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	22333393, 27648926	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17537267, 18069763, 26547586	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12381519, 15770721, 8396914	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10022251, 10398432, 10507782, 10868698, 11323185, 11431340, 12376500, 15197537, 15725609, 16003747, 16955540, 17026750, 17675654, 18544563, 21678399, 23569127, 26681036, 28604993, 28696911, 29258340, 8597119, 9107426, 9721868		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	10208649		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11984867, 17259654, 18199719, 18258609, 9626964, 9731715		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	22333393		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10868688, 29214875		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	31809667		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	15901993		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	18069763		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	18069763	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25689677		★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	18161794		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18322880	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10022251, 18022202, 18569593, 29518119, 30836144		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37626132	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	18268115	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11487538, 15637738, 16434594, 17537267, 18372103, 18569593, 19273964, 19549810, 22327651, 22905173, 26239303, 28714190, 29969986, 7627961, 9107426, 9528834		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16434594, 17537267, 18569593		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18022202, 19549810, 35485310, 9528834	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35485310	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	8895478		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	17438651, 9626964		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	15901993		★☆☆☆☆ Found in Text Mining only
Conotruncal cardiac defects	Conotruncal cardiac defect	Pubtator	21254360	Associate	★☆☆☆☆ Found in Text Mining only
CONOTRUNCAL HEART MALFORMATIONS (disorder)	Conotruncal heart defect	GWASCAT_DG	28468790		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11505222		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	19834256		★☆☆☆☆ Found in Text Mining only
Dermatitis, Occupational	Dermatitis	CTD_human_DG	19834256		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26409796, 36364703	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	36364703	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36364703	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34605855	Associate	★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	34605855	Associate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	10211944, 19368118		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	10585581		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15094455		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15094455		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15094455		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15094455		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35285582	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	19898993, 24151610, 24449363		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	38099560	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	15084249, 29339455	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	28714190		★☆☆☆☆ Found in Text Mining only
Industrial Dermatosis	Industrial Dermatosis	CTD_human_DG	19834256		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17537267		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	34605855	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	15770721		★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	LHGDN	12037388		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	11955677		★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15142884	Associate	★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	23168701		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	23168701		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11034589		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11266080		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	14705222		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	14705222		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23160945, 25689677		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16847422, 17522066, 19809881, 22890783, 23160945, 25689677		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	16847422, 17522066		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	16847422, 17522066, 19809881, 23160945		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	28714190		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15094455, 16513216		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	19898993, 24151610, 24449363		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10090301, 10698485, 12835615, 12860276, 14517345, 15084249, 15090724, 15226672, 16049806, 17010218, 17973251, 18288399, 22333393, 24467436, 25528056, 27648926, 28359264, 29315819, 29339455, 29901116, 29964355, 29969986, 31358821, 9610785		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25886288		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	10208649		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11984867, 17259654, 18199719, 18258609, 9626964, 9731715		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15987714, 18006927, 18499698, 9696930		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10211944, 12355549, 15685255, 20099048, 20570911, 20931357		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	12618593		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10918189, 12115538		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10022251, 10398432, 10507782, 10868698, 11323185, 11431340, 12376500, 15197537, 15725609, 16003747, 16955540, 17026750, 17675654, 18544563, 21678399, 23569127, 26681036, 28604993, 28696911, 29258340, 8597119, 9107426, 9626964, 9721868		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	16003747		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10211944, 10443949, 10585581, 10667461, 10720751, 10918189, 10998276, 11431340, 11470992, 12088197, 12088198, 12351146, 15901993, 16788383, 17537267, 18199719, 18259988, 18680469, 22090474, 23168701, 24467436, 25886288, 26681036, 29950659, 29969986, 7627961, 9528834, 9682272		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	11505221		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	11532862		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10022251, 18022202, 18569593, 29518119		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12860276, 17564319, 17973251		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15084249, 17973251, 29339455, 29901116		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	27693233		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	23168701	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18680472		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24625537		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	29343473		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10398432, 10585581, 10918189, 14517345, 15084249, 17973251, 20628863, 25528056, 26965286, 29969986, 30610490, 9770500, 9834266		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	11505221		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	15959877		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17700360		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11266080, 28202352		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17973251, 23183268, 24467436		★☆☆☆☆ Found in Text Mining only
Orofacial cleft	Orofacial Cleft	BEFREE	15127906, 15523664		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15987714, 18006927, 18499698, 9696930		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	9696930		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15987714, 18006927, 18499698	Associate	★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	18268115		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	22424094		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10211944, 12355549, 15685255, 20099048, 20570911, 20931357		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12355549		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12355549, 15717312		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	12618593		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	14608357		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	18569593		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11505222		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30285260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	30285260	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spina Bifida	Spina Bifida	BEFREE	15959877, 16680433, 17392017		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	LHGDN	15959877, 16680433		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11266080, 11532862, 9806162		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25886288		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10698480		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10918189, 12115538		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17646057	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	19809881		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29964355, 32555504	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12135032, 18322880		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	15523664		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10507782, 17026750, 23803105, 8110178, 8396914	Associate	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	34605855	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	30042310		★☆☆☆☆ Found in Text Mining only