Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10989
Gene name	Inner membrane mitochondrial protein
Gene symbol	IMMT
Synonyms (NCBI Gene)	HMPMICOS60MINOS2Mic60P87P87/89P89PIG4PIG52
Chromosome	2
Chromosome location	2p11.2\|2

155

Show/Hide all (155)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025510	hsa-miR-34a-5p	Proteomics	21566225
MIRT025510	hsa-miR-34a-5p	Proteomics	21566225
MIRT050824	hsa-miR-17-5p	CLASH	23622248
MIRT040039	hsa-miR-615-3p	CLASH	23622248
MIRT039513	hsa-miR-652-3p	CLASH	23622248
MIRT1065614	hsa-miR-186	CLIP-seq
MIRT1065615	hsa-miR-199a-3p	CLIP-seq
MIRT1065616	hsa-miR-199b-3p	CLIP-seq
MIRT1065617	hsa-miR-205	CLIP-seq
MIRT1065618	hsa-miR-3121-5p	CLIP-seq
MIRT1065619	hsa-miR-3129-5p	CLIP-seq
MIRT1065620	hsa-miR-34c-3p	CLIP-seq
MIRT1065621	hsa-miR-3616-3p	CLIP-seq
MIRT1065622	hsa-miR-3688-3p	CLIP-seq
MIRT1065623	hsa-miR-3978	CLIP-seq
MIRT1065624	hsa-miR-411	CLIP-seq
MIRT1065625	hsa-miR-421	CLIP-seq
MIRT1065626	hsa-miR-4305	CLIP-seq
MIRT1065627	hsa-miR-4328	CLIP-seq
MIRT1065628	hsa-miR-4457	CLIP-seq
MIRT1065629	hsa-miR-4497	CLIP-seq
MIRT1065630	hsa-miR-4694-3p	CLIP-seq
MIRT1065631	hsa-miR-4709-5p	CLIP-seq
MIRT1065632	hsa-miR-4719	CLIP-seq
MIRT1065633	hsa-miR-4757-5p	CLIP-seq
MIRT1065634	hsa-miR-4777-5p	CLIP-seq
MIRT1065635	hsa-miR-509-3p	CLIP-seq
MIRT1065636	hsa-miR-513b	CLIP-seq
MIRT1065637	hsa-miR-518d-5p	CLIP-seq
MIRT1065638	hsa-miR-519b-5p	CLIP-seq
MIRT1065639	hsa-miR-519c-5p	CLIP-seq
MIRT1065640	hsa-miR-520c-5p	CLIP-seq
MIRT1065641	hsa-miR-526a	CLIP-seq
MIRT1065642	hsa-miR-548p	CLIP-seq
MIRT1065643	hsa-miR-639	CLIP-seq
MIRT1065644	hsa-miR-720	CLIP-seq
MIRT1065615	hsa-miR-199a-3p	CLIP-seq
MIRT1065616	hsa-miR-199b-3p	CLIP-seq
MIRT1065619	hsa-miR-3129-5p	CLIP-seq
MIRT1065621	hsa-miR-3616-3p	CLIP-seq
MIRT2015600	hsa-miR-3941	CLIP-seq
MIRT1065624	hsa-miR-411	CLIP-seq
MIRT1065625	hsa-miR-421	CLIP-seq
MIRT1065627	hsa-miR-4328	CLIP-seq
MIRT2015601	hsa-miR-466	CLIP-seq
MIRT2015602	hsa-miR-4672	CLIP-seq
MIRT2015603	hsa-miR-4684-3p	CLIP-seq
MIRT1065631	hsa-miR-4709-5p	CLIP-seq
MIRT2015604	hsa-miR-4731-3p	CLIP-seq
MIRT2015605	hsa-miR-4801	CLIP-seq
MIRT2015606	hsa-miR-518a-5p	CLIP-seq
MIRT2015607	hsa-miR-527	CLIP-seq
MIRT1065644	hsa-miR-720	CLIP-seq
MIRT2247951	hsa-miR-101	CLIP-seq
MIRT1065615	hsa-miR-199a-3p	CLIP-seq
MIRT1065616	hsa-miR-199b-3p	CLIP-seq
MIRT1065617	hsa-miR-205	CLIP-seq
MIRT2247952	hsa-miR-30a	CLIP-seq
MIRT2247953	hsa-miR-30b	CLIP-seq
MIRT2247954	hsa-miR-30c	CLIP-seq
MIRT2247955	hsa-miR-30d	CLIP-seq
MIRT2247956	hsa-miR-30e	CLIP-seq
MIRT1065619	hsa-miR-3129-5p	CLIP-seq
MIRT1065621	hsa-miR-3616-3p	CLIP-seq
MIRT1065624	hsa-miR-411	CLIP-seq
MIRT1065625	hsa-miR-421	CLIP-seq
MIRT1065626	hsa-miR-4305	CLIP-seq
MIRT1065627	hsa-miR-4328	CLIP-seq
MIRT1065629	hsa-miR-4497	CLIP-seq
MIRT1065631	hsa-miR-4709-5p	CLIP-seq
MIRT1065634	hsa-miR-4777-5p	CLIP-seq
MIRT1065637	hsa-miR-518d-5p	CLIP-seq
MIRT1065638	hsa-miR-519b-5p	CLIP-seq
MIRT1065639	hsa-miR-519c-5p	CLIP-seq
MIRT1065640	hsa-miR-520c-5p	CLIP-seq
MIRT1065641	hsa-miR-526a	CLIP-seq
MIRT1065643	hsa-miR-639	CLIP-seq
MIRT1065644	hsa-miR-720	CLIP-seq
MIRT2247957	hsa-miR-767-3p	CLIP-seq
MIRT1065626	hsa-miR-4305	CLIP-seq
MIRT1065629	hsa-miR-4497	CLIP-seq
MIRT1065634	hsa-miR-4777-5p	CLIP-seq
MIRT1065637	hsa-miR-518d-5p	CLIP-seq
MIRT1065638	hsa-miR-519b-5p	CLIP-seq
MIRT1065639	hsa-miR-519c-5p	CLIP-seq
MIRT1065640	hsa-miR-520c-5p	CLIP-seq
MIRT1065641	hsa-miR-526a	CLIP-seq
MIRT1065644	hsa-miR-720	CLIP-seq
MIRT2247951	hsa-miR-101	CLIP-seq
MIRT1065614	hsa-miR-186	CLIP-seq
MIRT1065617	hsa-miR-205	CLIP-seq
MIRT2247952	hsa-miR-30a	CLIP-seq
MIRT2247953	hsa-miR-30b	CLIP-seq
MIRT2247954	hsa-miR-30c	CLIP-seq
MIRT2247955	hsa-miR-30d	CLIP-seq
MIRT2247956	hsa-miR-30e	CLIP-seq
MIRT2551700	hsa-miR-3143	CLIP-seq
MIRT2551701	hsa-miR-3647-3p	CLIP-seq
MIRT1065622	hsa-miR-3688-3p	CLIP-seq
MIRT2551702	hsa-miR-3934	CLIP-seq
MIRT1065623	hsa-miR-3978	CLIP-seq
MIRT1065626	hsa-miR-4305	CLIP-seq
MIRT1065629	hsa-miR-4497	CLIP-seq
MIRT2551703	hsa-miR-4517	CLIP-seq
MIRT1065630	hsa-miR-4694-3p	CLIP-seq
MIRT2551704	hsa-miR-4694-5p	CLIP-seq
MIRT2551705	hsa-miR-4773	CLIP-seq
MIRT1065634	hsa-miR-4777-5p	CLIP-seq
MIRT1065637	hsa-miR-518d-5p	CLIP-seq
MIRT1065638	hsa-miR-519b-5p	CLIP-seq
MIRT1065639	hsa-miR-519c-5p	CLIP-seq
MIRT1065640	hsa-miR-520c-5p	CLIP-seq
MIRT1065641	hsa-miR-526a	CLIP-seq
MIRT2551706	hsa-miR-543	CLIP-seq
MIRT1065642	hsa-miR-548p	CLIP-seq
MIRT2551707	hsa-miR-552	CLIP-seq
MIRT1065643	hsa-miR-639	CLIP-seq
MIRT1065644	hsa-miR-720	CLIP-seq
MIRT2247957	hsa-miR-767-3p	CLIP-seq
MIRT2247951	hsa-miR-101	CLIP-seq
MIRT1065614	hsa-miR-186	CLIP-seq
MIRT1065617	hsa-miR-205	CLIP-seq
MIRT2247952	hsa-miR-30a	CLIP-seq
MIRT2247953	hsa-miR-30b	CLIP-seq
MIRT2247954	hsa-miR-30c	CLIP-seq
MIRT2247955	hsa-miR-30d	CLIP-seq
MIRT2247956	hsa-miR-30e	CLIP-seq
MIRT1065618	hsa-miR-3121-5p	CLIP-seq
MIRT2551700	hsa-miR-3143	CLIP-seq
MIRT1065620	hsa-miR-34c-3p	CLIP-seq
MIRT2551701	hsa-miR-3647-3p	CLIP-seq
MIRT1065622	hsa-miR-3688-3p	CLIP-seq
MIRT2551702	hsa-miR-3934	CLIP-seq
MIRT1065623	hsa-miR-3978	CLIP-seq
MIRT1065626	hsa-miR-4305	CLIP-seq
MIRT1065629	hsa-miR-4497	CLIP-seq
MIRT2551703	hsa-miR-4517	CLIP-seq
MIRT1065630	hsa-miR-4694-3p	CLIP-seq
MIRT2551704	hsa-miR-4694-5p	CLIP-seq
MIRT2551705	hsa-miR-4773	CLIP-seq
MIRT1065634	hsa-miR-4777-5p	CLIP-seq
MIRT2682820	hsa-miR-489	CLIP-seq
MIRT2682821	hsa-miR-514	CLIP-seq
MIRT2682822	hsa-miR-514b-3p	CLIP-seq
MIRT1065637	hsa-miR-518d-5p	CLIP-seq
MIRT1065638	hsa-miR-519b-5p	CLIP-seq
MIRT1065639	hsa-miR-519c-5p	CLIP-seq
MIRT1065640	hsa-miR-520c-5p	CLIP-seq
MIRT1065641	hsa-miR-526a	CLIP-seq
MIRT2551706	hsa-miR-543	CLIP-seq
MIRT1065642	hsa-miR-548p	CLIP-seq
MIRT2551707	hsa-miR-552	CLIP-seq
MIRT1065643	hsa-miR-639	CLIP-seq
MIRT1065644	hsa-miR-720	CLIP-seq
MIRT2247957	hsa-miR-767-3p	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001401	Component	SAM complex	HDA	26477565
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	16169070, 17043677, 20880836, 21081504, 21900206, 22228767, 25764979, 25959826, 26168012, 26666268, 29128334, 30021884, 31379806, 31413325, 31644573, 32814053, 36127429
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	25781180, 25997101
GO:0005739	Component	Mitochondrion	IEA
GO:0005740	Component	Mitochondrial envelope	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	9168817, 25997101
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	25997101
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0007007	Process	Inner mitochondrial membrane organization	IC	26477565
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0042407	Process	Cristae formation	IBA
GO:0042407	Process	Cristae formation	IMP	25781180, 32567732, 33130824
GO:0042407	Process	Cristae formation	NAS	25997101
GO:0044284	Component	Mitochondrial crista junction	NAS	25997101
GO:0051560	Process	Mitochondrial calcium ion homeostasis	IEA
GO:0061617	Component	MICOS complex	HDA	26477565
GO:0061617	Component	MICOS complex	IBA
GO:0061617	Component	MICOS complex	IDA	25781180, 25997101
GO:0061617	Component	MICOS complex	IMP	32567732
GO:0061617	Component	MICOS complex	NAS	25997101
GO:0070050	Process	Neuron cellular homeostasis	IEA
GO:0140275	Component	MIB complex	HDA	26477565

MIM	HGNC	e!Ensembl
600378	6047	ENSG00000132305

Q16891

Protein name

MICOS complex subunit MIC60 (Cell proliferation-inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89)

Protein function

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane (PubMe

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09731	Mitofilin	41 → 746	Mitochondrial inner membrane protein	Family

Sequence

MLRACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGG
TILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKE
SKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGK
PTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIA
AQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKE
ELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQSEAKVVSQYHE
LVVQARDDFKRELDSITPEVLPGWKGMSVSDLADKLSTDDLNSLIAHAHRRIDQLNRELA
EQKATEKQHITLALEKQKLEEKRAFDSAVAKALEHHRSEIQAEQDRKIEEVRDAMENEMR
TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDIN
TAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAETPTIPLGSAVEAIK
ANCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFL
SYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRV
AQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQPE

Sequence length

758

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (68)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31583841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	26530043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	16969080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19535734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26272184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36899366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	12800201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25998931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36223343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37240154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30104387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	28088328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, progressive familial intrahepatic 1	Intrahepatic cholestasis	BEFREE	31750554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23594796, 31392094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23594796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18923054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18923054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	12469345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	9714461		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	23831462		★★★★★ ★☆☆☆☆ Found in Text Mining only
GIANT AXONAL NEUROPATHY 1	Giant Axonal Neuropathy	BEFREE	16565160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29619900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29619900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	27974200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17944996, 26972322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	25115524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jeune thoracic dystrophy	Jeune Thoracic Dystrophy	BEFREE	24140113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29619900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrothrombocytopenia	Macrothrombocytopenia	BEFREE	29090586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mainzer-Saldino Disease	Renal dysplasia, retinal pigmentary dystrophy, cerebellar ataxia and skeletal dysplasia	BEFREE	24140113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26272184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25998931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	12800201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24413182, 26530043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23594796, 23626713, 24487586, 24626146, 27020495, 29956808, 30047307, 31598400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	25115524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	29343805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvillus inclusion disease	Microvillus Inclusion Disease	BEFREE	24014347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	10505649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17999208, 24144874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12800201		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30740041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22382496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29060936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	12191989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	12191989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	31394789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	27696015, 27974214, 28598422, 31125351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	27696015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29721087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30740041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34148545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	11389829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	11389829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	26792819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive intrahepatic cholestasis (disorder)	Intrahepatic Cholestasis	BEFREE	31750554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24413182, 26530043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20646681		★★★★★ ★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	29090586, 30916803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	17981900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	26100331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	24808017, 29630822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37356748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Usher Syndrome	Usher Syndrome	BEFREE	28507101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	11027286, 20208140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group B	Xeroderma Pigmentosum	BEFREE	8196650		★★★★★ ★☆☆☆☆ Found in Text Mining only

IMMT (inner membrane mitochondrial protein)