MAPRE2 (microtubule associated protein RP/EB family member 2)

Gene

• Entrez ID: 10982
• Gene name: Microtubule associated protein RP/EB family member 2
• Gene symbol: MAPRE2
• Synonyms (NCBI Gene): CSCSC2, EB1, EB2, RP1
• Chromosome: 18
• Chromosome location: 18q12.1-q12.2
• Summary: The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs864309717	A>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs864309718	C>T	Pathogenic	Non coding transcript variant, stop gained, coding sequence variant
rs864309719	A>G	Pathogenic	Missense variant, non coding transcript variant, intron variant, coding sequence variant
rs864309720	C>T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1568991852	ACTATGAG>-	Likely-pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant, intron variant
rs1603400699	G>A	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005836	hsa-miR-204-5p	Microarray	21282569
MIRT037823	hsa-miR-455-3p	CLASH	23622248
MIRT556259	hsa-miR-216a-5p	PAR-CLIP	21572407
MIRT117348	hsa-miR-4501	PAR-CLIP	21572407
MIRT556258	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT556257	hsa-miR-4725-5p	PAR-CLIP	21572407
MIRT117345	hsa-miR-3171	PAR-CLIP	21572407
MIRT117347	hsa-miR-4480	PAR-CLIP	21572407
MIRT556256	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT556255	hsa-miR-567	PAR-CLIP	21572407
MIRT556254	hsa-miR-513c-5p	PAR-CLIP	21572407
MIRT556253	hsa-miR-514b-5p	PAR-CLIP	21572407
MIRT117341	hsa-miR-432-3p	PAR-CLIP	21572407
MIRT117344	hsa-miR-297	PAR-CLIP	21572407
MIRT443864	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443863	hsa-miR-3940-5p	PAR-CLIP	22100165
MIRT443862	hsa-miR-4507	PAR-CLIP	22100165
MIRT440277	hsa-miR-377-5p	HITS-CLIP	24374217
MIRT440277	hsa-miR-377-5p	HITS-CLIP	24374217
MIRT556259	hsa-miR-216a-5p	PAR-CLIP	21572407
MIRT117348	hsa-miR-4501	PAR-CLIP	21572407
MIRT556258	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT556257	hsa-miR-4725-5p	PAR-CLIP	21572407
MIRT117345	hsa-miR-3171	PAR-CLIP	21572407
MIRT117347	hsa-miR-4480	PAR-CLIP	21572407
MIRT556256	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT556255	hsa-miR-567	PAR-CLIP	21572407
MIRT556254	hsa-miR-513c-5p	PAR-CLIP	21572407
MIRT556253	hsa-miR-514b-5p	PAR-CLIP	21572407
MIRT117341	hsa-miR-432-3p	PAR-CLIP	21572407
MIRT117344	hsa-miR-297	PAR-CLIP	21572407
MIRT443864	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443863	hsa-miR-3940-5p	PAR-CLIP	22100165
MIRT443862	hsa-miR-4507	PAR-CLIP	22100165
MIRT1131752	hsa-miR-1253	CLIP-seq
MIRT1131753	hsa-miR-185	CLIP-seq
MIRT1131754	hsa-miR-300	CLIP-seq
MIRT1131755	hsa-miR-3662	CLIP-seq
MIRT1131756	hsa-miR-3692	CLIP-seq
MIRT1131757	hsa-miR-381	CLIP-seq
MIRT1131758	hsa-miR-4306	CLIP-seq
MIRT1131759	hsa-miR-4419a	CLIP-seq
MIRT1131760	hsa-miR-4468	CLIP-seq
MIRT1131761	hsa-miR-4510	CLIP-seq
MIRT1131762	hsa-miR-4644	CLIP-seq
MIRT1131763	hsa-miR-4722-5p	CLIP-seq
MIRT1131764	hsa-miR-4768-3p	CLIP-seq
MIRT2037527	hsa-miR-298	CLIP-seq
MIRT2037528	hsa-miR-3158-5p	CLIP-seq
MIRT2037529	hsa-miR-4418	CLIP-seq
MIRT2037530	hsa-miR-4651	CLIP-seq
MIRT2037531	hsa-miR-4694-5p	CLIP-seq
MIRT2037532	hsa-miR-509-3-5p	CLIP-seq
MIRT2037533	hsa-miR-509-5p	CLIP-seq
MIRT2037534	hsa-miR-583	CLIP-seq
MIRT2037535	hsa-miR-608	CLIP-seq
MIRT2037536	hsa-miR-944	CLIP-seq
MIRT2567199	hsa-miR-100	CLIP-seq
MIRT2567200	hsa-miR-1228	CLIP-seq
MIRT2567201	hsa-miR-1245b-3p	CLIP-seq
MIRT2567202	hsa-miR-125a-3p	CLIP-seq
MIRT2567203	hsa-miR-125a-5p	CLIP-seq
MIRT2567204	hsa-miR-125b	CLIP-seq
MIRT2567205	hsa-miR-1260	CLIP-seq
MIRT2567206	hsa-miR-1260b	CLIP-seq
MIRT2567207	hsa-miR-1267	CLIP-seq
MIRT2567208	hsa-miR-1269	CLIP-seq
MIRT2567209	hsa-miR-1269b	CLIP-seq
MIRT2567210	hsa-miR-1273f	CLIP-seq
MIRT2567211	hsa-miR-1276	CLIP-seq
MIRT2567212	hsa-miR-1288	CLIP-seq
MIRT2567213	hsa-miR-1292	CLIP-seq
MIRT2567214	hsa-miR-1293	CLIP-seq
MIRT2567215	hsa-miR-129-5p	CLIP-seq
MIRT2567216	hsa-miR-1299	CLIP-seq
MIRT2567217	hsa-miR-143	CLIP-seq
MIRT2567218	hsa-miR-153	CLIP-seq
MIRT2567219	hsa-miR-1827	CLIP-seq
MIRT2567220	hsa-miR-188-3p	CLIP-seq
MIRT2567221	hsa-miR-1911	CLIP-seq
MIRT2567222	hsa-miR-198	CLIP-seq
MIRT2567223	hsa-miR-2113	CLIP-seq
MIRT2567224	hsa-miR-2278	CLIP-seq
MIRT2567225	hsa-miR-24	CLIP-seq
MIRT2567226	hsa-miR-2964a-5p	CLIP-seq
MIRT2037527	hsa-miR-298	CLIP-seq
MIRT2567227	hsa-miR-3074-3p	CLIP-seq
MIRT2567228	hsa-miR-3117-5p	CLIP-seq
MIRT2567229	hsa-miR-3125	CLIP-seq
MIRT2567230	hsa-miR-3135	CLIP-seq
MIRT2567231	hsa-miR-3147	CLIP-seq
MIRT2567232	hsa-miR-3153	CLIP-seq
MIRT2567233	hsa-miR-3154	CLIP-seq
MIRT2567234	hsa-miR-3155	CLIP-seq
MIRT2567235	hsa-miR-3155b	CLIP-seq
MIRT2567236	hsa-miR-3156-3p	CLIP-seq
MIRT2037528	hsa-miR-3158-5p	CLIP-seq
MIRT2567237	hsa-miR-3170	CLIP-seq
MIRT2567238	hsa-miR-3174	CLIP-seq
MIRT2567239	hsa-miR-3185	CLIP-seq
MIRT2567240	hsa-miR-335	CLIP-seq
MIRT2567241	hsa-miR-337-5p	CLIP-seq
MIRT2567242	hsa-miR-342-5p	CLIP-seq
MIRT2567243	hsa-miR-34a	CLIP-seq
MIRT2567244	hsa-miR-34c-5p	CLIP-seq
MIRT2567245	hsa-miR-3646	CLIP-seq
MIRT2567246	hsa-miR-3667-5p	CLIP-seq
MIRT2567247	hsa-miR-3689a-3p	CLIP-seq
MIRT2567248	hsa-miR-3689c	CLIP-seq
MIRT2567249	hsa-miR-377	CLIP-seq
MIRT2567250	hsa-miR-3914	CLIP-seq
MIRT2567251	hsa-miR-3916	CLIP-seq
MIRT2567252	hsa-miR-3925-3p	CLIP-seq
MIRT2567253	hsa-miR-3934	CLIP-seq
MIRT2567254	hsa-miR-3978	CLIP-seq
MIRT2567255	hsa-miR-4251	CLIP-seq
MIRT2567256	hsa-miR-4260	CLIP-seq
MIRT2567257	hsa-miR-4273	CLIP-seq
MIRT2567258	hsa-miR-4276	CLIP-seq
MIRT2567259	hsa-miR-4311	CLIP-seq
MIRT2567260	hsa-miR-4318	CLIP-seq
MIRT2567261	hsa-miR-4319	CLIP-seq
MIRT2567262	hsa-miR-4324	CLIP-seq
MIRT2567263	hsa-miR-4328	CLIP-seq
MIRT2037529	hsa-miR-4418	CLIP-seq
MIRT2567264	hsa-miR-4425	CLIP-seq
MIRT2567265	hsa-miR-4438	CLIP-seq
MIRT2567266	hsa-miR-4453	CLIP-seq
MIRT1131760	hsa-miR-4468	CLIP-seq
MIRT2567267	hsa-miR-4471	CLIP-seq
MIRT2567268	hsa-miR-4474-3p	CLIP-seq
MIRT2567269	hsa-miR-4483	CLIP-seq
MIRT2567270	hsa-miR-4485	CLIP-seq
MIRT2567271	hsa-miR-449a	CLIP-seq
MIRT2567272	hsa-miR-449b	CLIP-seq
MIRT2567273	hsa-miR-4503	CLIP-seq
MIRT2567274	hsa-miR-4515	CLIP-seq
MIRT2567275	hsa-miR-4520b-3p	CLIP-seq
MIRT2567276	hsa-miR-4529-3p	CLIP-seq
MIRT2567277	hsa-miR-4538	CLIP-seq
MIRT2567278	hsa-miR-4643	CLIP-seq
MIRT2567279	hsa-miR-4645-3p	CLIP-seq
MIRT2567280	hsa-miR-4646-5p	CLIP-seq
MIRT2567281	hsa-miR-4648	CLIP-seq
MIRT2037530	hsa-miR-4651	CLIP-seq
MIRT2567282	hsa-miR-4652-3p	CLIP-seq
MIRT2567283	hsa-miR-4654	CLIP-seq
MIRT2567284	hsa-miR-4664-5p	CLIP-seq
MIRT2567285	hsa-miR-4668-5p	CLIP-seq
MIRT2567286	hsa-miR-4677-5p	CLIP-seq
MIRT2567287	hsa-miR-4693-5p	CLIP-seq
MIRT2037531	hsa-miR-4694-5p	CLIP-seq
MIRT2567288	hsa-miR-4703-3p	CLIP-seq
MIRT2567289	hsa-miR-4708-5p	CLIP-seq
MIRT2567290	hsa-miR-4709-5p	CLIP-seq
MIRT2567291	hsa-miR-4728-5p	CLIP-seq
MIRT2567292	hsa-miR-4731-3p	CLIP-seq
MIRT2567293	hsa-miR-4733-3p	CLIP-seq
MIRT2567294	hsa-miR-4740-5p	CLIP-seq
MIRT2567295	hsa-miR-4751	CLIP-seq
MIRT2567296	hsa-miR-4769-5p	CLIP-seq
MIRT2567297	hsa-miR-4770	CLIP-seq
MIRT2567298	hsa-miR-4782-5p	CLIP-seq
MIRT2567299	hsa-miR-4801	CLIP-seq
MIRT2567300	hsa-miR-484	CLIP-seq
MIRT2567301	hsa-miR-490-3p	CLIP-seq
MIRT2567302	hsa-miR-504	CLIP-seq
MIRT2037532	hsa-miR-509-3-5p	CLIP-seq
MIRT2037533	hsa-miR-509-5p	CLIP-seq
MIRT2567303	hsa-miR-515-5p	CLIP-seq
MIRT2567304	hsa-miR-516b	CLIP-seq
MIRT2567305	hsa-miR-520a-5p	CLIP-seq
MIRT2567306	hsa-miR-525-5p	CLIP-seq
MIRT2567307	hsa-miR-539	CLIP-seq
MIRT2567308	hsa-miR-542-5p	CLIP-seq
MIRT2567309	hsa-miR-548a-3p	CLIP-seq
MIRT2567310	hsa-miR-548e	CLIP-seq
MIRT2567311	hsa-miR-548f	CLIP-seq
MIRT2567312	hsa-miR-582-3p	CLIP-seq
MIRT2037534	hsa-miR-583	CLIP-seq
MIRT2567313	hsa-miR-604	CLIP-seq
MIRT2037535	hsa-miR-608	CLIP-seq
MIRT2567314	hsa-miR-647	CLIP-seq
MIRT2567315	hsa-miR-649	CLIP-seq
MIRT2567316	hsa-miR-7	CLIP-seq
MIRT2567317	hsa-miR-758	CLIP-seq
MIRT2567318	hsa-miR-764	CLIP-seq
MIRT2567319	hsa-miR-766	CLIP-seq
MIRT2567320	hsa-miR-875-3p	CLIP-seq
MIRT2567321	hsa-miR-892a	CLIP-seq
MIRT2567322	hsa-miR-9	CLIP-seq
MIRT2567323	hsa-miR-940	CLIP-seq
MIRT2567324	hsa-miR-99a	CLIP-seq
MIRT2567325	hsa-miR-99b	CLIP-seq
MIRT2567199	hsa-miR-100	CLIP-seq
MIRT2567200	hsa-miR-1228	CLIP-seq
MIRT2567201	hsa-miR-1245b-3p	CLIP-seq
MIRT2567202	hsa-miR-125a-3p	CLIP-seq
MIRT2567203	hsa-miR-125a-5p	CLIP-seq
MIRT2567204	hsa-miR-125b	CLIP-seq
MIRT2567205	hsa-miR-1260	CLIP-seq
MIRT2567206	hsa-miR-1260b	CLIP-seq
MIRT2567207	hsa-miR-1267	CLIP-seq
MIRT2567208	hsa-miR-1269	CLIP-seq
MIRT2567209	hsa-miR-1269b	CLIP-seq
MIRT2567210	hsa-miR-1273f	CLIP-seq
MIRT2567211	hsa-miR-1276	CLIP-seq
MIRT2567212	hsa-miR-1288	CLIP-seq
MIRT2567213	hsa-miR-1292	CLIP-seq
MIRT2567214	hsa-miR-1293	CLIP-seq
MIRT2567215	hsa-miR-129-5p	CLIP-seq
MIRT2567216	hsa-miR-1299	CLIP-seq
MIRT2567217	hsa-miR-143	CLIP-seq
MIRT2567218	hsa-miR-153	CLIP-seq
MIRT2567219	hsa-miR-1827	CLIP-seq
MIRT2567220	hsa-miR-188-3p	CLIP-seq
MIRT2567221	hsa-miR-1911	CLIP-seq
MIRT2567222	hsa-miR-198	CLIP-seq
MIRT2567223	hsa-miR-2113	CLIP-seq
MIRT2567224	hsa-miR-2278	CLIP-seq
MIRT2567225	hsa-miR-24	CLIP-seq
MIRT2567226	hsa-miR-2964a-5p	CLIP-seq
MIRT2037527	hsa-miR-298	CLIP-seq
MIRT2567227	hsa-miR-3074-3p	CLIP-seq
MIRT2567228	hsa-miR-3117-5p	CLIP-seq
MIRT2567229	hsa-miR-3125	CLIP-seq
MIRT2567230	hsa-miR-3135	CLIP-seq
MIRT2567231	hsa-miR-3147	CLIP-seq
MIRT2567232	hsa-miR-3153	CLIP-seq
MIRT2567234	hsa-miR-3155	CLIP-seq
MIRT2567235	hsa-miR-3155b	CLIP-seq
MIRT2567236	hsa-miR-3156-3p	CLIP-seq
MIRT2037528	hsa-miR-3158-5p	CLIP-seq
MIRT2567237	hsa-miR-3170	CLIP-seq
MIRT2567238	hsa-miR-3174	CLIP-seq
MIRT2567239	hsa-miR-3185	CLIP-seq
MIRT2567240	hsa-miR-335	CLIP-seq
MIRT2567241	hsa-miR-337-5p	CLIP-seq
MIRT2567242	hsa-miR-342-5p	CLIP-seq
MIRT2567243	hsa-miR-34a	CLIP-seq
MIRT2567244	hsa-miR-34c-5p	CLIP-seq
MIRT2567245	hsa-miR-3646	CLIP-seq
MIRT2567246	hsa-miR-3667-5p	CLIP-seq
MIRT2567247	hsa-miR-3689a-3p	CLIP-seq
MIRT2567248	hsa-miR-3689c	CLIP-seq
MIRT2567249	hsa-miR-377	CLIP-seq
MIRT2567250	hsa-miR-3914	CLIP-seq
MIRT2567251	hsa-miR-3916	CLIP-seq
MIRT2567252	hsa-miR-3925-3p	CLIP-seq
MIRT2567253	hsa-miR-3934	CLIP-seq
MIRT2567254	hsa-miR-3978	CLIP-seq
MIRT2567255	hsa-miR-4251	CLIP-seq
MIRT2567256	hsa-miR-4260	CLIP-seq
MIRT2567257	hsa-miR-4273	CLIP-seq
MIRT2567258	hsa-miR-4276	CLIP-seq
MIRT2567259	hsa-miR-4311	CLIP-seq
MIRT2567260	hsa-miR-4318	CLIP-seq
MIRT2567261	hsa-miR-4319	CLIP-seq
MIRT2567262	hsa-miR-4324	CLIP-seq
MIRT2567263	hsa-miR-4328	CLIP-seq
MIRT2037529	hsa-miR-4418	CLIP-seq
MIRT2567264	hsa-miR-4425	CLIP-seq
MIRT2567265	hsa-miR-4438	CLIP-seq
MIRT2567266	hsa-miR-4453	CLIP-seq
MIRT1131760	hsa-miR-4468	CLIP-seq
MIRT2567267	hsa-miR-4471	CLIP-seq
MIRT2567268	hsa-miR-4474-3p	CLIP-seq
MIRT2567269	hsa-miR-4483	CLIP-seq
MIRT2567270	hsa-miR-4485	CLIP-seq
MIRT2567271	hsa-miR-449a	CLIP-seq
MIRT2567272	hsa-miR-449b	CLIP-seq
MIRT2567274	hsa-miR-4515	CLIP-seq
MIRT2567275	hsa-miR-4520b-3p	CLIP-seq
MIRT2567276	hsa-miR-4529-3p	CLIP-seq
MIRT2567277	hsa-miR-4538	CLIP-seq
MIRT2567278	hsa-miR-4643	CLIP-seq
MIRT2567279	hsa-miR-4645-3p	CLIP-seq
MIRT2567280	hsa-miR-4646-5p	CLIP-seq
MIRT2567281	hsa-miR-4648	CLIP-seq
MIRT2037530	hsa-miR-4651	CLIP-seq
MIRT2567282	hsa-miR-4652-3p	CLIP-seq
MIRT2567283	hsa-miR-4654	CLIP-seq
MIRT2567284	hsa-miR-4664-5p	CLIP-seq
MIRT2567285	hsa-miR-4668-5p	CLIP-seq
MIRT2567286	hsa-miR-4677-5p	CLIP-seq
MIRT2567287	hsa-miR-4693-5p	CLIP-seq
MIRT2037531	hsa-miR-4694-5p	CLIP-seq
MIRT2567288	hsa-miR-4703-3p	CLIP-seq
MIRT2567289	hsa-miR-4708-5p	CLIP-seq
MIRT2567290	hsa-miR-4709-5p	CLIP-seq
MIRT2567291	hsa-miR-4728-5p	CLIP-seq
MIRT2567292	hsa-miR-4731-3p	CLIP-seq
MIRT2567293	hsa-miR-4733-3p	CLIP-seq
MIRT2567294	hsa-miR-4740-5p	CLIP-seq
MIRT2567295	hsa-miR-4751	CLIP-seq
MIRT2567296	hsa-miR-4769-5p	CLIP-seq
MIRT2567297	hsa-miR-4770	CLIP-seq
MIRT2567298	hsa-miR-4782-5p	CLIP-seq
MIRT2567299	hsa-miR-4801	CLIP-seq
MIRT2567300	hsa-miR-484	CLIP-seq
MIRT2567301	hsa-miR-490-3p	CLIP-seq
MIRT2567302	hsa-miR-504	CLIP-seq
MIRT2037532	hsa-miR-509-3-5p	CLIP-seq
MIRT2037533	hsa-miR-509-5p	CLIP-seq
MIRT2567303	hsa-miR-515-5p	CLIP-seq
MIRT2567304	hsa-miR-516b	CLIP-seq
MIRT2567305	hsa-miR-520a-5p	CLIP-seq
MIRT2567306	hsa-miR-525-5p	CLIP-seq
MIRT2567307	hsa-miR-539	CLIP-seq
MIRT2567308	hsa-miR-542-5p	CLIP-seq
MIRT2567309	hsa-miR-548a-3p	CLIP-seq
MIRT2567310	hsa-miR-548e	CLIP-seq
MIRT2567311	hsa-miR-548f	CLIP-seq
MIRT2567312	hsa-miR-582-3p	CLIP-seq
MIRT2037534	hsa-miR-583	CLIP-seq
MIRT2567313	hsa-miR-604	CLIP-seq
MIRT2037535	hsa-miR-608	CLIP-seq
MIRT2567314	hsa-miR-647	CLIP-seq
MIRT2567315	hsa-miR-649	CLIP-seq
MIRT2567316	hsa-miR-7	CLIP-seq
MIRT2567317	hsa-miR-758	CLIP-seq
MIRT2567318	hsa-miR-764	CLIP-seq
MIRT2567319	hsa-miR-766	CLIP-seq
MIRT2567320	hsa-miR-875-3p	CLIP-seq
MIRT2567321	hsa-miR-892a	CLIP-seq
MIRT2567322	hsa-miR-9	CLIP-seq
MIRT2567323	hsa-miR-940	CLIP-seq
MIRT2567324	hsa-miR-99a	CLIP-seq
MIRT2567325	hsa-miR-99b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 27107012, 27173435, 28514442, 31515488, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	HDA	16791210
GO:0005737	Component	Cytoplasm	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005881	Component	Cytoplasmic microtubule	IBA
GO:0005925	Component	Focal adhesion	IDA	25490267
GO:0005925	Component	Focal adhesion	IEA
GO:0008017	Function	Microtubule binding	IDA	25490267
GO:0008017	Function	Microtubule binding	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0019901	Function	Protein kinase binding	IEA
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IBA
GO:0032014	Process	Positive regulation of ARF protein signal transduction	IEA
GO:0032014	Process	Positive regulation of ARF protein signal transduction	ISS	25490267
GO:0035371	Component	Microtubule plus-end	IBA
GO:0035372	Process	Protein localization to microtubule	IBA
GO:0042802	Function	Identical protein binding	IPI	16189514, 25416956, 32296183
GO:0051010	Function	Microtubule plus-end binding	IBA
GO:0051010	Function	Microtubule plus-end binding	IEA
GO:0051225	Process	Spindle assembly	IBA
GO:0051233	Component	Spindle midzone	IBA
GO:0051301	Process	Cell division	IEA
GO:0051549	Process	Positive regulation of keratinocyte migration	IEA
GO:0051549	Process	Positive regulation of keratinocyte migration	ISS	25490267
GO:0120183	Process	Positive regulation of focal adhesion disassembly	IEA
GO:0120183	Process	Positive regulation of focal adhesion disassembly	ISS	25490267

Other IDs

• MIM: 605789
• HGNC: 6891
• e!Ensembl: ENSG00000166974

Protein

• UniProt ID: Q15555
• Protein name: Microtubule-associated protein RP/EB family member 2 (APC-binding protein EB2) (End-binding protein 2) (EB2)
• Protein function: Adapter protein that is involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. Therefore, ensures mitotic progression and genome stability (PubMed:27030108). Acts as a central
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00307	CH	57 → 163	Calponin homology (CH) domain	Domain
  PF03271	EB1	261 → 299	EB1-like C-terminal motif	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes. {ECO:0000269|PubMed:9233623}.
• Sequence:

  MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSR
  HDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKL
  LQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIP
  PPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDL
  ETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYAS
  EEHEGHTEEPEAEEQAHEQQPPQQEEY

• Sequence length: 327

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Developmental disorder	Likely pathogenic; Pathogenic	rs864309720	RCV003126592	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Skin creases, congenital symmetric circumferential, 2	Likely pathogenic; Pathogenic	rs2523915654, rs864309717, rs864309718, rs864309719, rs864309720, rs1568991852, rs1603400699	RCV002283747 RCV000203280 RCV000203284 RCV000203276 RCV000203279 RCV000781519 RCV000856827	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRUGADA SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAPRE2-related disorder	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	9823979		★☆☆☆☆ Found in Text Mining only
Albinism	Albinism	Pubtator	39596324	Associate	★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber type 1	Leber congenital amaurosis	Pubtator	33712029	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10366101	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	32565670	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	7610041	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26061684	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	37493686	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Choroideremia	Choroideremia	Pubtator	23940504	Associate	★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	31253780, 39596324	Associate	★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Color Vision Defects	Color vision deficiency	Pubtator	23940504	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11593399, 28903393, 9233623, 9823979		★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	37493686	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	GENOMICS_ENGLAND_DG	15863674		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	29049012	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	31502381		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	16504044	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	18295997	Inhibit	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15460906	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	GWASCAT_DG	18997786, 20364137		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	GWASDB_DG	18997786, 20364137		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	31250579	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	20578947		★☆☆☆☆ Found in Text Mining only
Leber Congenital Amaurosis	Leber congenital amaurosis	Pubtator	23940504, 31253780	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16769578		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18937283		★☆☆☆☆ Found in Text Mining only
Localized neuroblastoma	Neuroblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	32565670, 34183725	Associate	★☆☆☆☆ Found in Text Mining only
Methylmalonic Aciduria and Homocystinuria CblF Type	Methylmalonic acidemia	Pubtator	35709987	Associate	★☆☆☆☆ Found in Text Mining only
Michelin tire baby syndrome	Michelin Tire Baby Syndrome	ORPHANET_DG	26637975		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microcornea	Microcornea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple benign circumferential skin creases on limbs	Multiple Benign Circumferential Skin Creases On Limbs	Orphanet			★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30094535, 9823979		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10588946		★☆☆☆☆ Found in Text Mining only
Nyctalopia	Nyctalopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	23844040	Associate	★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	16769578		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	16769578		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	10391212, 10484783, 32423767, 32565670, 40724865	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	10845615		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	CLINVAR_DG	30718709		★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	BEFREE	30913292		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	CLINVAR_DG	10391211, 10484783, 11095597, 16597330, 24265693, 26497376		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	10391212, 10484783, 11864893, 15994872, 16568030, 16597330, 16799052, 19339744, 20664799, 21347327, 22052604, 22110072, 23049240, 23077400, 23940504, 23950152, 24265693, 24339724, 24940031, 25494902, 26321861, 27307693, 29843741, 29912909, 31059986, 31960602, 32005865, 32100970, 32565670, 32587456, 32749464, 32795431, 33247286, 35205402, 35814500, 37493686, 37648803, 39457414, 40168954, 40225919, 40296824	Associate	★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	11527933, 12882812, 15933747, 16597330, 25088982		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	LHGDN	12882812, 15863674, 15980210, 16568030, 18347624, 18552984		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	GENOMICS_ENGLAND_DG	15863674		★☆☆☆☆ Found in Text Mining only
Retinitis pigmentosa	Retinitis Pigmentosa	Orphanet			★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	32098976	Stimulate	★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 1	Retinitis Pigmentosa	UNIPROT_DG	10391211, 10484783, 11095597, 15863674, 15933747, 19956407, 20664799, 22052604, 22334370		★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 1	Retinitis Pigmentosa	CLINVAR_DG	10391211		★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 1	Retinitis Pigmentosa	GENOMICS_ENGLAND_DG	15863674		★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 1	Retinitis Pigmentosa	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	GENOMICS_ENGLAND_DG	15863674		★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
SKIN CREASES, CONGENITAL SYMMETRIC CIRCUMFERENTIAL, 1	Skin Creases, Congenital Symmetric Circumferential	BEFREE	26637975		★☆☆☆☆ Found in Text Mining only
SKIN CREASES, CONGENITAL SYMMETRIC CIRCUMFERENTIAL, 2	Skin Creases, Congenital Symmetric Circumferential	UNIPROT_DG	26637975		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SKIN CREASES, CONGENITAL SYMMETRIC CIRCUMFERENTIAL, 2	Skin Creases, Congenital Symmetric Circumferential	GENOMICS_ENGLAND_DG	26637975		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SKIN CREASES, CONGENITAL SYMMETRIC CIRCUMFERENTIAL, 2	Skin Creases, Congenital Symmetric Circumferential	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Squamous cell carcinoma	Carcinoma	LHGDN	16007168		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27208742		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29358861	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28903393		★☆☆☆☆ Found in Text Mining only
Urogenital Abnormalities	Urogenital abnormalities	Pubtator	37584388	Associate	★☆☆☆☆ Found in Text Mining only
Usher Syndromes	Usher syndrome	Pubtator	23940504	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	23219444	Associate	★☆☆☆☆ Found in Text Mining only