Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10979
Gene name	FERM domain containing kindlin 2
Gene symbol	FERMT2
Synonyms (NCBI Gene)	KIND2MIG2PLEKHC1UNC112UNC112Bmig-2
Chromosome	14
Chromosome location	14q22.1

300

Show/Hide all (300)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005281	hsa-miR-1-3p	pSILAC	18668040
MIRT005281	hsa-miR-1-3p	Proteomics	18668040
MIRT031065	hsa-miR-21-5p	Microarray	20371350
MIRT046125	hsa-miR-30b-5p	CLASH	23622248
MIRT054683	hsa-miR-200b-3p	KYSE150	24064224
MIRT054683	hsa-miR-200b-3p	KYSE150	24064224
MIRT054683	hsa-miR-200b-3p	KYSE150	24064224
MIRT054683	hsa-miR-200b-3p	KYSE150	24064224
MIRT507277	hsa-miR-138-5p	PAR-CLIP	23446348
MIRT507276	hsa-miR-8084	PAR-CLIP	23446348
MIRT507275	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT507274	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT507273	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT507272	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT507271	hsa-miR-940	PAR-CLIP	23446348
MIRT507270	hsa-miR-2682-5p	PAR-CLIP	23446348
MIRT507269	hsa-miR-34b-5p	PAR-CLIP	23446348
MIRT507268	hsa-miR-449c-5p	PAR-CLIP	23446348
MIRT507267	hsa-miR-8062	PAR-CLIP	23446348
MIRT507266	hsa-miR-4728-3p	PAR-CLIP	23446348
MIRT507265	hsa-miR-1324	PAR-CLIP	23446348
MIRT507264	hsa-miR-4299	PAR-CLIP	23446348
MIRT507263	hsa-miR-3166	PAR-CLIP	23446348
MIRT507262	hsa-miR-133a-5p	PAR-CLIP	23446348
MIRT507261	hsa-miR-6131	PAR-CLIP	23446348
MIRT507260	hsa-miR-4423-3p	PAR-CLIP	23446348
MIRT440645	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440645	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT507277	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	26474967
MIRT507277	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	26474967
MIRT507277	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	26474967
MIRT507277	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	26474967
MIRT507277	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	26474967
MIRT507277	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	26474967
MIRT735914	hsa-miR-200c-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)ImmunofluorescenceqRT-PCR	33125708
MIRT507277	hsa-miR-138-5p	PAR-CLIP	23446348
MIRT507276	hsa-miR-8084	PAR-CLIP	23446348
MIRT507275	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT507274	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT507273	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT507272	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT507271	hsa-miR-940	PAR-CLIP	23446348
MIRT507270	hsa-miR-2682-5p	PAR-CLIP	23446348
MIRT507269	hsa-miR-34b-5p	PAR-CLIP	23446348
MIRT507268	hsa-miR-449c-5p	PAR-CLIP	23446348
MIRT507267	hsa-miR-8062	PAR-CLIP	23446348
MIRT507266	hsa-miR-4728-3p	PAR-CLIP	23446348
MIRT507265	hsa-miR-1324	PAR-CLIP	23446348
MIRT507264	hsa-miR-4299	PAR-CLIP	23446348
MIRT507263	hsa-miR-3166	PAR-CLIP	23446348
MIRT507262	hsa-miR-133a-5p	PAR-CLIP	23446348
MIRT507261	hsa-miR-6131	PAR-CLIP	23446348
MIRT507260	hsa-miR-4423-3p	PAR-CLIP	23446348
MIRT994774	hsa-miR-1	CLIP-seq
MIRT994775	hsa-miR-103a	CLIP-seq
MIRT994776	hsa-miR-107	CLIP-seq
MIRT994777	hsa-miR-1200	CLIP-seq
MIRT994778	hsa-miR-124	CLIP-seq
MIRT994779	hsa-miR-1246	CLIP-seq
MIRT994780	hsa-miR-1279	CLIP-seq
MIRT994781	hsa-miR-1291	CLIP-seq
MIRT994782	hsa-miR-1297	CLIP-seq
MIRT994783	hsa-miR-1305	CLIP-seq
MIRT994784	hsa-miR-130a	CLIP-seq
MIRT994785	hsa-miR-130b	CLIP-seq
MIRT994786	hsa-miR-1587	CLIP-seq
MIRT994787	hsa-miR-15a	CLIP-seq
MIRT994788	hsa-miR-15b	CLIP-seq
MIRT994789	hsa-miR-16	CLIP-seq
MIRT994790	hsa-miR-195	CLIP-seq
MIRT994791	hsa-miR-200b	CLIP-seq
MIRT994792	hsa-miR-200c	CLIP-seq
MIRT994793	hsa-miR-2054	CLIP-seq
MIRT994794	hsa-miR-206	CLIP-seq
MIRT994795	hsa-miR-221	CLIP-seq
MIRT994796	hsa-miR-222	CLIP-seq
MIRT994797	hsa-miR-26a	CLIP-seq
MIRT994798	hsa-miR-26b	CLIP-seq
MIRT994799	hsa-miR-301a	CLIP-seq
MIRT994800	hsa-miR-301b	CLIP-seq
MIRT994801	hsa-miR-3074-3p	CLIP-seq
MIRT994802	hsa-miR-328	CLIP-seq
MIRT994803	hsa-miR-3591-5p	CLIP-seq
MIRT994804	hsa-miR-3663-5p	CLIP-seq
MIRT994805	hsa-miR-3666	CLIP-seq
MIRT994806	hsa-miR-3675-3p	CLIP-seq
MIRT994807	hsa-miR-3682-5p	CLIP-seq
MIRT994808	hsa-miR-3688-5p	CLIP-seq
MIRT994809	hsa-miR-3714	CLIP-seq
MIRT994810	hsa-miR-376a	CLIP-seq
MIRT994811	hsa-miR-376b	CLIP-seq
MIRT994812	hsa-miR-3910	CLIP-seq
MIRT994813	hsa-miR-3912	CLIP-seq
MIRT994814	hsa-miR-3935	CLIP-seq
MIRT994815	hsa-miR-410	CLIP-seq
MIRT994816	hsa-miR-411	CLIP-seq
MIRT994817	hsa-miR-424	CLIP-seq
MIRT994818	hsa-miR-4287	CLIP-seq
MIRT994819	hsa-miR-4289	CLIP-seq
MIRT994820	hsa-miR-429	CLIP-seq
MIRT994821	hsa-miR-4295	CLIP-seq
MIRT994822	hsa-miR-4301	CLIP-seq
MIRT994823	hsa-miR-4326	CLIP-seq
MIRT994824	hsa-miR-4328	CLIP-seq
MIRT994825	hsa-miR-4424	CLIP-seq
MIRT994826	hsa-miR-4465	CLIP-seq
MIRT994827	hsa-miR-4469	CLIP-seq
MIRT994828	hsa-miR-4470	CLIP-seq
MIRT994829	hsa-miR-4473	CLIP-seq
MIRT994830	hsa-miR-4474-3p	CLIP-seq
MIRT994831	hsa-miR-4477a	CLIP-seq
MIRT994832	hsa-miR-4477b	CLIP-seq
MIRT994833	hsa-miR-4484	CLIP-seq
MIRT994834	hsa-miR-4490	CLIP-seq
MIRT994835	hsa-miR-4503	CLIP-seq
MIRT994836	hsa-miR-4504	CLIP-seq
MIRT994837	hsa-miR-4521	CLIP-seq
MIRT994838	hsa-miR-4527	CLIP-seq
MIRT994839	hsa-miR-454	CLIP-seq
MIRT994840	hsa-miR-4655-3p	CLIP-seq
MIRT994841	hsa-miR-4671-3p	CLIP-seq
MIRT994842	hsa-miR-4674	CLIP-seq
MIRT994843	hsa-miR-4685-3p	CLIP-seq
MIRT994844	hsa-miR-4686	CLIP-seq
MIRT994845	hsa-miR-4756-3p	CLIP-seq
MIRT994846	hsa-miR-4760-3p	CLIP-seq
MIRT994847	hsa-miR-4774-5p	CLIP-seq
MIRT994848	hsa-miR-4775	CLIP-seq
MIRT994849	hsa-miR-4795-3p	CLIP-seq
MIRT994850	hsa-miR-487a	CLIP-seq
MIRT994851	hsa-miR-490-5p	CLIP-seq
MIRT994852	hsa-miR-495	CLIP-seq
MIRT994853	hsa-miR-497	CLIP-seq
MIRT994854	hsa-miR-506	CLIP-seq
MIRT994855	hsa-miR-518a-5p	CLIP-seq
MIRT994856	hsa-miR-527	CLIP-seq
MIRT994857	hsa-miR-542-3p	CLIP-seq
MIRT994858	hsa-miR-548a-3p	CLIP-seq
MIRT994859	hsa-miR-548an	CLIP-seq
MIRT994860	hsa-miR-548e	CLIP-seq
MIRT994861	hsa-miR-548f	CLIP-seq
MIRT994862	hsa-miR-548v	CLIP-seq
MIRT994863	hsa-miR-582-3p	CLIP-seq
MIRT994864	hsa-miR-613	CLIP-seq
MIRT994865	hsa-miR-633	CLIP-seq
MIRT994866	hsa-miR-636	CLIP-seq
MIRT994867	hsa-miR-944	CLIP-seq
MIRT994774	hsa-miR-1	CLIP-seq
MIRT994780	hsa-miR-1279	CLIP-seq
MIRT994781	hsa-miR-1291	CLIP-seq
MIRT994782	hsa-miR-1297	CLIP-seq
MIRT994793	hsa-miR-2054	CLIP-seq
MIRT994794	hsa-miR-206	CLIP-seq
MIRT994797	hsa-miR-26a	CLIP-seq
MIRT994798	hsa-miR-26b	CLIP-seq
MIRT994868	hsa-miR-29a	CLIP-seq
MIRT994869	hsa-miR-29b	CLIP-seq
MIRT994870	hsa-miR-29c	CLIP-seq
MIRT994801	hsa-miR-3074-3p	CLIP-seq
MIRT994871	hsa-miR-323b-3p	CLIP-seq
MIRT994802	hsa-miR-328	CLIP-seq
MIRT994807	hsa-miR-3682-5p	CLIP-seq
MIRT994810	hsa-miR-376a	CLIP-seq
MIRT994811	hsa-miR-376b	CLIP-seq
MIRT994826	hsa-miR-4465	CLIP-seq
MIRT994836	hsa-miR-4504	CLIP-seq
MIRT994837	hsa-miR-4521	CLIP-seq
MIRT994872	hsa-miR-4698	CLIP-seq
MIRT994873	hsa-miR-4731-3p	CLIP-seq
MIRT994846	hsa-miR-4760-3p	CLIP-seq
MIRT994849	hsa-miR-4795-3p	CLIP-seq
MIRT994874	hsa-miR-4801	CLIP-seq
MIRT994875	hsa-miR-508-3p	CLIP-seq
MIRT994855	hsa-miR-518a-5p	CLIP-seq
MIRT994856	hsa-miR-527	CLIP-seq
MIRT994857	hsa-miR-542-3p	CLIP-seq
MIRT994864	hsa-miR-613	CLIP-seq
MIRT1556347	hsa-miR-338-5p	CLIP-seq
MIRT1556348	hsa-miR-433	CLIP-seq
MIRT994835	hsa-miR-4503	CLIP-seq
MIRT1995054	hsa-miR-2682	CLIP-seq
MIRT1995055	hsa-miR-449c	CLIP-seq
MIRT2229084	hsa-miR-1179	CLIP-seq
MIRT994825	hsa-miR-4424	CLIP-seq
MIRT994832	hsa-miR-4477b	CLIP-seq
MIRT994774	hsa-miR-1	CLIP-seq
MIRT2428875	hsa-miR-1244	CLIP-seq
MIRT994781	hsa-miR-1291	CLIP-seq
MIRT994783	hsa-miR-1305	CLIP-seq
MIRT2428876	hsa-miR-154	CLIP-seq
MIRT2428877	hsa-miR-194	CLIP-seq
MIRT994794	hsa-miR-206	CLIP-seq
MIRT994868	hsa-miR-29a	CLIP-seq
MIRT994869	hsa-miR-29b	CLIP-seq
MIRT994870	hsa-miR-29c	CLIP-seq
MIRT2428878	hsa-miR-3121-3p	CLIP-seq
MIRT2428879	hsa-miR-3163	CLIP-seq
MIRT2428880	hsa-miR-323-3p	CLIP-seq
MIRT994871	hsa-miR-323b-3p	CLIP-seq
MIRT994802	hsa-miR-328	CLIP-seq
MIRT1556347	hsa-miR-338-5p	CLIP-seq
MIRT2428881	hsa-miR-340	CLIP-seq
MIRT2428882	hsa-miR-4282	CLIP-seq
MIRT994822	hsa-miR-4301	CLIP-seq
MIRT994824	hsa-miR-4328	CLIP-seq
MIRT2428883	hsa-miR-4435	CLIP-seq
MIRT994837	hsa-miR-4521	CLIP-seq
MIRT2428884	hsa-miR-4717-3p	CLIP-seq
MIRT994846	hsa-miR-4760-3p	CLIP-seq
MIRT2428885	hsa-miR-4773	CLIP-seq
MIRT994875	hsa-miR-508-3p	CLIP-seq
MIRT994858	hsa-miR-548a-3p	CLIP-seq
MIRT2428886	hsa-miR-548ae	CLIP-seq
MIRT2428887	hsa-miR-548aj	CLIP-seq
MIRT2428888	hsa-miR-548am	CLIP-seq
MIRT994860	hsa-miR-548e	CLIP-seq
MIRT994861	hsa-miR-548f	CLIP-seq
MIRT2428889	hsa-miR-548g	CLIP-seq
MIRT2428890	hsa-miR-548x	CLIP-seq
MIRT2428891	hsa-miR-586	CLIP-seq
MIRT2428892	hsa-miR-590-3p	CLIP-seq
MIRT2428893	hsa-miR-599	CLIP-seq
MIRT994864	hsa-miR-613	CLIP-seq
MIRT2532744	hsa-miR-1275	CLIP-seq
MIRT2428877	hsa-miR-194	CLIP-seq
MIRT2532745	hsa-miR-1972	CLIP-seq
MIRT2532746	hsa-miR-1976	CLIP-seq
MIRT994868	hsa-miR-29a	CLIP-seq
MIRT994869	hsa-miR-29b	CLIP-seq
MIRT994870	hsa-miR-29c	CLIP-seq
MIRT994801	hsa-miR-3074-3p	CLIP-seq
MIRT2532747	hsa-miR-3145-3p	CLIP-seq
MIRT2428880	hsa-miR-323-3p	CLIP-seq
MIRT994871	hsa-miR-323b-3p	CLIP-seq
MIRT994808	hsa-miR-3688-5p	CLIP-seq
MIRT994814	hsa-miR-3935	CLIP-seq
MIRT994816	hsa-miR-411	CLIP-seq
MIRT2532748	hsa-miR-4260	CLIP-seq
MIRT2532749	hsa-miR-4278	CLIP-seq
MIRT994819	hsa-miR-4289	CLIP-seq
MIRT1556348	hsa-miR-433	CLIP-seq
MIRT994825	hsa-miR-4424	CLIP-seq
MIRT2428883	hsa-miR-4435	CLIP-seq
MIRT994828	hsa-miR-4470	CLIP-seq
MIRT994830	hsa-miR-4474-3p	CLIP-seq
MIRT994832	hsa-miR-4477b	CLIP-seq
MIRT2532750	hsa-miR-455-3p	CLIP-seq
MIRT2532751	hsa-miR-4645-5p	CLIP-seq
MIRT2532752	hsa-miR-4650-5p	CLIP-seq
MIRT2532753	hsa-miR-4665-5p	CLIP-seq
MIRT2532754	hsa-miR-4673	CLIP-seq
MIRT2532755	hsa-miR-4694-3p	CLIP-seq
MIRT2532756	hsa-miR-4716-3p	CLIP-seq
MIRT2532757	hsa-miR-4723-5p	CLIP-seq
MIRT2428885	hsa-miR-4773	CLIP-seq
MIRT994848	hsa-miR-4775	CLIP-seq
MIRT994875	hsa-miR-508-3p	CLIP-seq
MIRT2532758	hsa-miR-522	CLIP-seq
MIRT994858	hsa-miR-548a-3p	CLIP-seq
MIRT994860	hsa-miR-548e	CLIP-seq
MIRT994861	hsa-miR-548f	CLIP-seq
MIRT2532744	hsa-miR-1275	CLIP-seq
MIRT2428877	hsa-miR-194	CLIP-seq
MIRT2532745	hsa-miR-1972	CLIP-seq
MIRT2532746	hsa-miR-1976	CLIP-seq
MIRT994868	hsa-miR-29a	CLIP-seq
MIRT994869	hsa-miR-29b	CLIP-seq
MIRT994870	hsa-miR-29c	CLIP-seq
MIRT994801	hsa-miR-3074-3p	CLIP-seq
MIRT2532747	hsa-miR-3145-3p	CLIP-seq
MIRT2428880	hsa-miR-323-3p	CLIP-seq
MIRT994871	hsa-miR-323b-3p	CLIP-seq
MIRT994808	hsa-miR-3688-5p	CLIP-seq
MIRT994814	hsa-miR-3935	CLIP-seq
MIRT994816	hsa-miR-411	CLIP-seq
MIRT2532748	hsa-miR-4260	CLIP-seq
MIRT2532749	hsa-miR-4278	CLIP-seq
MIRT994819	hsa-miR-4289	CLIP-seq
MIRT1556348	hsa-miR-433	CLIP-seq
MIRT994825	hsa-miR-4424	CLIP-seq
MIRT2428883	hsa-miR-4435	CLIP-seq
MIRT994828	hsa-miR-4470	CLIP-seq
MIRT994830	hsa-miR-4474-3p	CLIP-seq
MIRT994832	hsa-miR-4477b	CLIP-seq
MIRT2532750	hsa-miR-455-3p	CLIP-seq
MIRT2532751	hsa-miR-4645-5p	CLIP-seq
MIRT2532752	hsa-miR-4650-5p	CLIP-seq
MIRT2532753	hsa-miR-4665-5p	CLIP-seq
MIRT2532754	hsa-miR-4673	CLIP-seq
MIRT2532755	hsa-miR-4694-3p	CLIP-seq
MIRT2532756	hsa-miR-4716-3p	CLIP-seq
MIRT2428884	hsa-miR-4717-3p	CLIP-seq
MIRT2532757	hsa-miR-4723-5p	CLIP-seq
MIRT2428885	hsa-miR-4773	CLIP-seq
MIRT994848	hsa-miR-4775	CLIP-seq
MIRT994875	hsa-miR-508-3p	CLIP-seq
MIRT2532758	hsa-miR-522	CLIP-seq
MIRT994858	hsa-miR-548a-3p	CLIP-seq
MIRT994860	hsa-miR-548e	CLIP-seq
MIRT994861	hsa-miR-548f	CLIP-seq

Show/Hide all (82)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IEA
GO:0003779	Function	Actin binding	IMP	29496737
GO:0005178	Function	Integrin binding	IBA
GO:0005515	Function	Protein binding	IPI	22699938, 25160619
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	21325030, 22030399
GO:0005634	Component	Nucleus	IDA	22699938
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	18528435, 22699938, 28799653
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	23723426
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	23723426, 30382829
GO:0005886	Component	Plasma membrane	IEA
GO:0005912	Component	Adherens junction	IDA	28799653
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	18528435, 21325030, 29162887, 29496737
GO:0005925	Component	Focal adhesion	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IGI	21356350
GO:0007155	Process	Cell adhesion	IMP	30382829
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IMP	21325030
GO:0007160	Process	Cell-matrix adhesion	ISS
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	21325030
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	21325030
GO:0008289	Function	Lipid binding	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	21325030
GO:0009986	Component	Cell surface	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	24226523
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IMP	22699938
GO:0019901	Function	Protein kinase binding	IPI	30254023
GO:0022604	Process	Regulation of cell morphogenesis	IMP	30254023
GO:0030054	Component	Cell junction	IDA	30382829
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	30382829
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0031674	Component	I band	IEA
GO:0033622	Process	Integrin activation	IEA
GO:0033622	Process	Integrin activation	IMP	22030399
GO:0033625	Process	Positive regulation of integrin activation	IGI	21356350
GO:0034334	Process	Adherens junction maintenance	IEA
GO:0034334	Process	Adherens junction maintenance	IMP	28799653
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	ISS
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IPI	23723426
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IMP	29496737
GO:0042995	Component	Cell projection	IEA
GO:0043116	Process	Negative regulation of vascular permeability	IEA
GO:0043116	Process	Negative regulation of vascular permeability	IMP	28799653
GO:0043539	Function	Protein serine/threonine kinase activator activity	IMP	29496737
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IMP	29496737
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	29496737
GO:0046332	Function	SMAD binding	IPI	23723426
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0048041	Process	Focal adhesion assembly	IMP	21356350
GO:0048041	Process	Focal adhesion assembly	ISS
GO:0051015	Function	Actin filament binding	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	29496737
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	29496737
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	24226523
GO:0060173	Process	Limb development	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	24226523
GO:0072657	Process	Protein localization to membrane	IEA
GO:0072657	Process	Protein localization to membrane	ISS
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	29496737
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IGI	30254023
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	23723426
GO:1902414	Process	Protein localization to cell junction	IMP	30254023
GO:1902462	Process	Positive regulation of mesenchymal stem cell proliferation	IMP	29496737
GO:1903691	Process	Positive regulation of wound healing, spreading of epidermal cells	IMP	21356350

MIM	HGNC	e!Ensembl
607746	15767	ENSG00000073712

Q96AC1

Protein name

Fermitin family homolog 2 (Kindlin-2) (Mitogen-inducible gene 2 protein) (MIG-2) (Pleckstrin homology domain-containing family C member 1) (PH domain-containing family C member 1)

Protein function

Scaffolding protein that enhances integrin activation mediated by TLN1 and/or TLN2, but activates integrins only weakly by itself. Binds to membranes enriched in phosphoinositides. Enhances integrin-mediated cell adhesion onto the extracellular

PDB

2LGX , 2LKO , 2MSU , 4F7H , 6U4N , 6XTJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18124	Kindlin_2_N	13 → 97	Kindlin-2 N-terminal domain	Domain
PF00373	FERM_M	281 → 573	FERM central domain	Domain
PF00169	PH	375 → 476	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Found in numerous tumor tissues.

Sequence

MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARIL
EAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDAST
GDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRA
KDQNESLDEEMFYKLTSGWV

Sequence length

680

Interactions

View interactions

	Reactome
			Cell-extracellular matrix interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGLE CLOSURE GLAUCOMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA, ANGLE-CLOSURE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY ANGLE CLOSURE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (90)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30783087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25114068, 26543236, 27215977, 28199971, 30286791, 30371777, 31561366, 33144711, 33213512, 34092785, 37101235, 38511601	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	36480537	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	27244899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	24162737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	24162737, 29777097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29340569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	29340569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	CTD_human_DG	27064256		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	31377279		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25724625, 28093281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	21624607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28881595, 30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23211537, 23483548, 23645746, 25790908, 28687620, 29743493, 30287284, 30460471, 31308359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17189381, 28755003, 30236106, 30477537, 32436609, 40643553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21821115, 25152024, 27713156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	32169902	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28969700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	30236106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28881595, 30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33850477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	40179422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24583125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	30426406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	28677779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28199971, 29340569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25633062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36480537	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital leukocyte adherence deficiency	Congenital Leukocyte Adherence Deficiency	BEFREE	19854292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31767831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28677779, 30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31427543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37480504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24583125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28667517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28667517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25605255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31292295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	14745725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	14745725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	30399154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25152024, 27713156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27713156, 30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31767831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	37480504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	28755003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31767831		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31767831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32169902	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23723426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	28775002		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	14745725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	18505917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	31292295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	31292295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28969700, 30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28755003	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23211537, 23483548, 23645746, 25790908, 28687620, 29743493, 30287284, 30460471, 31308359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28667517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28093281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	GWASDB_DG	23535732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23508013, 23857544, 30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	21624607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28881595, 30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28969700		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30581152, 31427543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29340569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36849997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22699938, 23211537, 24583125, 26334393, 28667517, 28677779, 28687620, 28969700, 30386175, 30460471, 30783087, 31308359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32169902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24788522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28223823, 30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	31292295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28093281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23508013, 25724625, 30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34638957, 38431242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37142218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Poikiloderma of Kindler	Poikiloderma Of Kindler	BEFREE	18528435, 19854292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	GWASCAT_DG	27064256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	31377279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	23535732, 29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23337877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28677779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	23723426, 31825843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	28775002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24064224, 26334393, 30386175, 30576425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23857544, 30386175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32377753	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	14745725		★★★★★ ★☆☆☆☆ Found in Text Mining only

FERMT2 (FERM domain containing kindlin 2)