Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10970
Gene name	Cytoskeleton associated protein 4
Gene symbol	CKAP4
Synonyms (NCBI Gene)	CLIMP-63CLIMP63ERGIC-63p63
Chromosome	12
Chromosome location	12q23.3

260

Show/Hide all (260)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004057	hsa-miR-7-5p	Microarray	19073608
MIRT022457	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT024515	hsa-miR-215-5p	Microarray	19074876
MIRT004057	hsa-miR-7-5p	Sequencing	20371350
MIRT004057	hsa-miR-7-5p	Microarray;Other	19073608
MIRT026345	hsa-miR-192-5p	Microarray	19074876
MIRT047962	hsa-miR-30c-5p	CLASH	23622248
MIRT040356	hsa-miR-615-3p	CLASH	23622248
MIRT036830	hsa-miR-877-3p	CLASH	23622248
MIRT036501	hsa-miR-1226-3p	CLASH	23622248
MIRT668984	hsa-miR-1247-3p	HITS-CLIP	23313552
MIRT639313	hsa-miR-370-3p	HITS-CLIP	23313552
MIRT639310	hsa-miR-6893-3p	HITS-CLIP	23313552
MIRT668983	hsa-miR-6087	HITS-CLIP	23313552
MIRT639311	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT639309	hsa-miR-4327	HITS-CLIP	23313552
MIRT668982	hsa-miR-25-5p	HITS-CLIP	23313552
MIRT639308	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT639307	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT639306	hsa-miR-5089-3p	HITS-CLIP	23313552
MIRT704671	hsa-miR-4435	HITS-CLIP	23313552
MIRT639305	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT639316	hsa-miR-4418	HITS-CLIP	23824327
MIRT639317	hsa-miR-509-3-5p	HITS-CLIP	23824327
MIRT639315	hsa-miR-509-5p	HITS-CLIP	23824327
MIRT639314	hsa-miR-217	HITS-CLIP	23824327
MIRT639312	hsa-miR-6807-3p	HITS-CLIP	23824327
MIRT639304	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT668984	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT639313	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT639310	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT668983	hsa-miR-6087	HITS-CLIP	23824327
MIRT639311	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT639309	hsa-miR-4327	HITS-CLIP	23824327
MIRT668982	hsa-miR-25-5p	HITS-CLIP	23824327
MIRT639308	hsa-miR-6807-5p	HITS-CLIP	23824327
MIRT639307	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT639306	hsa-miR-5089-3p	HITS-CLIP	23824327
MIRT639305	hsa-miR-6516-5p	HITS-CLIP	23824327
MIRT639316	hsa-miR-4418	HITS-CLIP	23824327
MIRT639317	hsa-miR-509-3-5p	HITS-CLIP	23824327
MIRT639315	hsa-miR-509-5p	HITS-CLIP	23824327
MIRT639314	hsa-miR-217	HITS-CLIP	23824327
MIRT639312	hsa-miR-6807-3p	HITS-CLIP	23824327
MIRT639313	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT639310	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT639311	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT639309	hsa-miR-4327	HITS-CLIP	23824327
MIRT639308	hsa-miR-6807-5p	HITS-CLIP	23824327
MIRT639307	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT639306	hsa-miR-5089-3p	HITS-CLIP	23824327
MIRT639305	hsa-miR-6516-5p	HITS-CLIP	23824327
MIRT639304	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT004057	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blotting	32346440
MIRT668984	hsa-miR-1247-3p	HITS-CLIP	23313552
MIRT639313	hsa-miR-370-3p	HITS-CLIP	23313552
MIRT639310	hsa-miR-6893-3p	HITS-CLIP	23313552
MIRT668983	hsa-miR-6087	HITS-CLIP	23313552
MIRT639311	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT639309	hsa-miR-4327	HITS-CLIP	23313552
MIRT668982	hsa-miR-25-5p	HITS-CLIP	23313552
MIRT639308	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT639307	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT639306	hsa-miR-5089-3p	HITS-CLIP	23313552
MIRT704671	hsa-miR-4435	HITS-CLIP	23313552
MIRT639305	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT639316	hsa-miR-4418	HITS-CLIP	23824327
MIRT639317	hsa-miR-509-3-5p	HITS-CLIP	23824327
MIRT639315	hsa-miR-509-5p	HITS-CLIP	23824327
MIRT639314	hsa-miR-217	HITS-CLIP	23824327
MIRT639312	hsa-miR-6807-3p	HITS-CLIP	23824327
MIRT639304	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT668984	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT639313	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT639310	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT668983	hsa-miR-6087	HITS-CLIP	23824327
MIRT639311	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT639309	hsa-miR-4327	HITS-CLIP	23824327
MIRT668982	hsa-miR-25-5p	HITS-CLIP	23824327
MIRT639308	hsa-miR-6807-5p	HITS-CLIP	23824327
MIRT639307	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT639306	hsa-miR-5089-3p	HITS-CLIP	23824327
MIRT639305	hsa-miR-6516-5p	HITS-CLIP	23824327
MIRT639316	hsa-miR-4418	HITS-CLIP	23824327
MIRT639317	hsa-miR-509-3-5p	HITS-CLIP	23824327
MIRT639315	hsa-miR-509-5p	HITS-CLIP	23824327
MIRT639314	hsa-miR-217	HITS-CLIP	23824327
MIRT639312	hsa-miR-6807-3p	HITS-CLIP	23824327
MIRT639313	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT639310	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT639311	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT639309	hsa-miR-4327	HITS-CLIP	23824327
MIRT639308	hsa-miR-6807-5p	HITS-CLIP	23824327
MIRT639307	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT639306	hsa-miR-5089-3p	HITS-CLIP	23824327
MIRT639305	hsa-miR-6516-5p	HITS-CLIP	23824327
MIRT639304	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT894131	hsa-miR-128	CLIP-seq
MIRT894132	hsa-miR-1321	CLIP-seq
MIRT894133	hsa-miR-142-3p	CLIP-seq
MIRT894134	hsa-miR-181a	CLIP-seq
MIRT894135	hsa-miR-181b	CLIP-seq
MIRT894136	hsa-miR-181c	CLIP-seq
MIRT894137	hsa-miR-181d	CLIP-seq
MIRT894138	hsa-miR-1827	CLIP-seq
MIRT894139	hsa-miR-2053	CLIP-seq
MIRT894140	hsa-miR-23a	CLIP-seq
MIRT894141	hsa-miR-23b	CLIP-seq
MIRT894142	hsa-miR-23c	CLIP-seq
MIRT894143	hsa-miR-27a	CLIP-seq
MIRT894144	hsa-miR-27b	CLIP-seq
MIRT894145	hsa-miR-3126-5p	CLIP-seq
MIRT894146	hsa-miR-3182	CLIP-seq
MIRT894147	hsa-miR-3612	CLIP-seq
MIRT894148	hsa-miR-3977	CLIP-seq
MIRT894149	hsa-miR-4262	CLIP-seq
MIRT894150	hsa-miR-4419a	CLIP-seq
MIRT894151	hsa-miR-4455	CLIP-seq
MIRT894152	hsa-miR-4473	CLIP-seq
MIRT894153	hsa-miR-4510	CLIP-seq
MIRT894154	hsa-miR-4649-3p	CLIP-seq
MIRT894155	hsa-miR-4652-3p	CLIP-seq
MIRT894156	hsa-miR-4686	CLIP-seq
MIRT894157	hsa-miR-4687-5p	CLIP-seq
MIRT894158	hsa-miR-4731-5p	CLIP-seq
MIRT894159	hsa-miR-4739	CLIP-seq
MIRT894160	hsa-miR-4756-5p	CLIP-seq
MIRT894161	hsa-miR-512-3p	CLIP-seq
MIRT894162	hsa-miR-513a-5p	CLIP-seq
MIRT894163	hsa-miR-520f	CLIP-seq
MIRT894164	hsa-miR-569	CLIP-seq
MIRT894165	hsa-miR-579	CLIP-seq
MIRT894166	hsa-miR-582-5p	CLIP-seq
MIRT894167	hsa-miR-609	CLIP-seq
MIRT894168	hsa-miR-650	CLIP-seq
MIRT1546450	hsa-miR-1254	CLIP-seq
MIRT1546451	hsa-miR-153	CLIP-seq
MIRT1546452	hsa-miR-3116	CLIP-seq
MIRT1546453	hsa-miR-448	CLIP-seq
MIRT1965104	hsa-miR-186	CLIP-seq
MIRT1965105	hsa-miR-2277-3p	CLIP-seq
MIRT1965106	hsa-miR-31	CLIP-seq
MIRT1965107	hsa-miR-3133	CLIP-seq
MIRT1965108	hsa-miR-3144-5p	CLIP-seq
MIRT1965109	hsa-miR-3160-3p	CLIP-seq
MIRT1965110	hsa-miR-3190	CLIP-seq
MIRT1965111	hsa-miR-3191	CLIP-seq
MIRT1965112	hsa-miR-34a	CLIP-seq
MIRT1965113	hsa-miR-34c-5p	CLIP-seq
MIRT1965114	hsa-miR-3660	CLIP-seq
MIRT1965115	hsa-miR-3973	CLIP-seq
MIRT1965116	hsa-miR-4282	CLIP-seq
MIRT1965117	hsa-miR-449a	CLIP-seq
MIRT1965118	hsa-miR-449b	CLIP-seq
MIRT1965119	hsa-miR-4526	CLIP-seq
MIRT1965120	hsa-miR-4652-5p	CLIP-seq
MIRT1965121	hsa-miR-4665-3p	CLIP-seq
MIRT1965122	hsa-miR-4696	CLIP-seq
MIRT1965123	hsa-miR-4796-3p	CLIP-seq
MIRT1965124	hsa-miR-491-5p	CLIP-seq
MIRT1965125	hsa-miR-513a-3p	CLIP-seq
MIRT1965126	hsa-miR-520g	CLIP-seq
MIRT1965127	hsa-miR-520h	CLIP-seq
MIRT1965128	hsa-miR-539	CLIP-seq
MIRT1965129	hsa-miR-548c-3p	CLIP-seq
MIRT1965130	hsa-miR-556-5p	CLIP-seq
MIRT1965131	hsa-miR-671-3p	CLIP-seq
MIRT1965132	hsa-miR-7	CLIP-seq
MIRT2201102	hsa-miR-1202	CLIP-seq
MIRT2201103	hsa-miR-1324	CLIP-seq
MIRT2201104	hsa-miR-133a	CLIP-seq
MIRT2201105	hsa-miR-133b	CLIP-seq
MIRT2201106	hsa-miR-1915	CLIP-seq
MIRT2201107	hsa-miR-2355-5p	CLIP-seq
MIRT2201108	hsa-miR-3120-3p	CLIP-seq
MIRT2201109	hsa-miR-3167	CLIP-seq
MIRT2201110	hsa-miR-3194-5p	CLIP-seq
MIRT2201111	hsa-miR-3202	CLIP-seq
MIRT2201112	hsa-miR-3667-5p	CLIP-seq
MIRT2201113	hsa-miR-3941	CLIP-seq
MIRT2201114	hsa-miR-3972	CLIP-seq
MIRT2201115	hsa-miR-4257	CLIP-seq
MIRT2201116	hsa-miR-4270	CLIP-seq
MIRT2201117	hsa-miR-4275	CLIP-seq
MIRT2201118	hsa-miR-4303	CLIP-seq
MIRT2201119	hsa-miR-4441	CLIP-seq
MIRT2201120	hsa-miR-4640-3p	CLIP-seq
MIRT894154	hsa-miR-4649-3p	CLIP-seq
MIRT2201121	hsa-miR-466	CLIP-seq
MIRT2201122	hsa-miR-4667-3p	CLIP-seq
MIRT2201123	hsa-miR-4672	CLIP-seq
MIRT2201124	hsa-miR-4713-5p	CLIP-seq
MIRT2201125	hsa-miR-4727-5p	CLIP-seq
MIRT2201126	hsa-miR-4731-3p	CLIP-seq
MIRT2201127	hsa-miR-4747-5p	CLIP-seq
MIRT2201128	hsa-miR-4762-3p	CLIP-seq
MIRT2201129	hsa-miR-4769-3p	CLIP-seq
MIRT2201130	hsa-miR-4801	CLIP-seq
MIRT2201131	hsa-miR-503	CLIP-seq
MIRT1965128	hsa-miR-539	CLIP-seq
MIRT2201132	hsa-miR-545	CLIP-seq
MIRT2201133	hsa-miR-607	CLIP-seq
MIRT2201134	hsa-miR-876-5p	CLIP-seq
MIRT2201106	hsa-miR-1915	CLIP-seq
MIRT2201112	hsa-miR-3667-5p	CLIP-seq
MIRT2201122	hsa-miR-4667-3p	CLIP-seq
MIRT2201124	hsa-miR-4713-5p	CLIP-seq
MIRT2427328	hsa-miR-105	CLIP-seq
MIRT2427329	hsa-miR-146a	CLIP-seq
MIRT2427330	hsa-miR-146b-5p	CLIP-seq
MIRT894143	hsa-miR-27a	CLIP-seq
MIRT894144	hsa-miR-27b	CLIP-seq
MIRT2427331	hsa-miR-298	CLIP-seq
MIRT2427332	hsa-miR-3658	CLIP-seq
MIRT2427333	hsa-miR-3919	CLIP-seq
MIRT2427334	hsa-miR-3925-5p	CLIP-seq
MIRT2427335	hsa-miR-4496	CLIP-seq
MIRT894162	hsa-miR-513a-5p	CLIP-seq
MIRT2427336	hsa-miR-549	CLIP-seq
MIRT2427337	hsa-miR-604	CLIP-seq
MIRT2427338	hsa-miR-873	CLIP-seq
MIRT2503878	hsa-miR-3913-3p	CLIP-seq
MIRT2201113	hsa-miR-3941	CLIP-seq
MIRT2503879	hsa-miR-4446-3p	CLIP-seq
MIRT2503880	hsa-miR-4448	CLIP-seq
MIRT2503881	hsa-miR-4470	CLIP-seq
MIRT2201121	hsa-miR-466	CLIP-seq
MIRT2201123	hsa-miR-4672	CLIP-seq
MIRT2201126	hsa-miR-4731-3p	CLIP-seq
MIRT2201130	hsa-miR-4801	CLIP-seq
MIRT2503882	hsa-miR-490-5p	CLIP-seq
MIRT2503883	hsa-miR-501-3p	CLIP-seq
MIRT2503884	hsa-miR-502-3p	CLIP-seq
MIRT2503885	hsa-miR-502-5p	CLIP-seq
MIRT2503886	hsa-miR-548al	CLIP-seq
MIRT1965105	hsa-miR-2277-3p	CLIP-seq
MIRT2201107	hsa-miR-2355-5p	CLIP-seq
MIRT1965110	hsa-miR-3190	CLIP-seq
MIRT2503878	hsa-miR-3913-3p	CLIP-seq
MIRT2201113	hsa-miR-3941	CLIP-seq
MIRT1965115	hsa-miR-3973	CLIP-seq
MIRT2503879	hsa-miR-4446-3p	CLIP-seq
MIRT2503880	hsa-miR-4448	CLIP-seq
MIRT2503881	hsa-miR-4470	CLIP-seq
MIRT2201120	hsa-miR-4640-3p	CLIP-seq
MIRT2201121	hsa-miR-466	CLIP-seq
MIRT2201123	hsa-miR-4672	CLIP-seq
MIRT2201126	hsa-miR-4731-3p	CLIP-seq
MIRT1965123	hsa-miR-4796-3p	CLIP-seq
MIRT2201130	hsa-miR-4801	CLIP-seq
MIRT2503882	hsa-miR-490-5p	CLIP-seq
MIRT2503883	hsa-miR-501-3p	CLIP-seq
MIRT2503884	hsa-miR-502-3p	CLIP-seq
MIRT2503885	hsa-miR-502-5p	CLIP-seq
MIRT1965126	hsa-miR-520g	CLIP-seq
MIRT1965127	hsa-miR-520h	CLIP-seq
MIRT2503886	hsa-miR-548al	CLIP-seq
MIRT1965130	hsa-miR-556-5p	CLIP-seq
MIRT1965131	hsa-miR-671-3p	CLIP-seq
MIRT1965132	hsa-miR-7	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	28514442, 32075961, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005783	Component	Endoplasmic reticulum	IDA	19401338
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005791	Component	Rough endoplasmic reticulum	IBA
GO:0005791	Component	Rough endoplasmic reticulum	IDA	24454821
GO:0005811	Component	Lipid droplet	IDA	14741744
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8314870
GO:0016607	Component	Nuclear speck	IDA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0035579	Component	Specific granule membrane	TAS
GO:0042599	Component	Lamellar body	TAS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
618595	16991	ENSG00000136026

Q07065

Protein name

Cytoskeleton-associated protein 4 (63-kDa cytoskeleton-linking membrane protein) (Climp-63) (p63)

Protein function

Mediates the anchoring of the endoplasmic reticulum to microtubules. ; High-affinity epithelial cell surface receptor for the FZD8-related low molecular weight sialoglycopeptide APF/antiproliferative facto

Family and domains

Sequence

MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQ
NQAHGKGGHRGGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAA
AFSGWCVHHVLEEVQQVRRSHQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQ
HKQDLTEKAVKQGESEVSRISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEER
LTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSA
KSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSE
ESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGV
LSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQL
VLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLK
ASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHE
KV

Sequence length

602

Interactions

View interactions

	KEGG		Reactome
	Protein processing in endoplasmic reticulum		Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Surfactant metabolism Neutrophil degranulation Post-translational protein phosphorylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (209)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24481878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11727253, 14562279, 14612504, 15551738, 16575619, 16884378, 20332665, 22935826, 24166777, 24194854, 25189640, 25982011, 27889037, 28394798, 28417484 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	11727253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25189640, 26603857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	29894516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	16445626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	31653135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	16575619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	26332336, 31711519		★★★★★ ★☆☆☆☆ Found in Text Mining only
ADULT SYNDROME	ADULT Syndrome	BEFREE	11929852, 16724007, 17041931, 18388131, 19781362, 20543567, 23407076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	15752257, 28390135, 31187467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta	Amelogenesis imperfecta	BEFREE	16546853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10594758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	12234063		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22053213, 30610103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	18603493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23837456, 26315281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	24482479		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12838557, 16918993, 26332336, 31831043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	11727253, 14562279, 21703447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy and Epispadias Complex	Bladder Exstrophy And Epispadias Complex	BEFREE	23913486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10910040, 12368193, 22253920, 22361733, 24213852, 28794159, 29956121, 30104251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12007564, 12653579, 14689049, 15489655, 15849742, 17639392, 19173015, 20225093, 20552547, 23548208, 24316488, 27555661, 28349272, 29484502, 31524947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19144824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10897041, 10910040, 11358835, 11381365, 11592094, 11948487, 11956072, 12185332, 12358808, 14654529, 15183414, 15489655, 15752257, 16445626, 17385050 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24863391, 36718957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12368193, 14654529, 22253920, 22361733, 24213852, 28794159, 29956121, 30104251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	15768819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	14612504, 15466179, 20332665, 22441934, 25982011, 29751934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30337687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	11532371, 12358808, 26068789, 31278765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	11381365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23095717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	24418859, 28821190		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	16884378, 20442293, 30973901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10568821, 20442293, 21980285, 30973901, 31211485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondroblastoma	Chondroblastoma	BEFREE	18192965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	29441939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	22569967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	16979518, 30359635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21906144, 30447004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37055577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22155142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16575619, 30393117, 31056618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16575619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	23548208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ankyloblepharon	Congenital Ankyloblepharon	BEFREE	12692135, 12766194, 12932250, 17164413, 21965674, 22329826, 23407076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Foot Deformity	Congenital deformity of foot	BEFREE	11787035, 17915261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29716728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29187877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	20128632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	30925220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	17030514, 19144824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29442026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	26768665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	15248062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	23355676, 31413199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	26332336, 31711519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22751441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	12185332, 20225093, 25810244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11474290, 12653579, 20225093, 25810244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	BEFREE	11879774, 11903230, 12766194, 15550149, 15725251, 16187309, 16546853, 16679535, 16691622, 16724007, 17164413, 17224651, 18603493, 19676060, 21471985 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	BEFREE	10769197, 11012604, 11462173, 11595015, 11929852, 12164578, 12766194, 14656652, 14699611, 17041931, 22069181, 22342398, 30566872		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	21652629, 23355676, 23355677, 24569166, 28513979, 30566872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	26768665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	22441934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22441934, 28511869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17616998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	28595997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	17264681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	12447998, 19725154, 24718831, 29563607, 30181180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12447998, 24718831, 29563607, 30181180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	18769338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	BEFREE	19840326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	25256005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28480888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	11474290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	16979518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	18192965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30288057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29396915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	16393253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hay-Wells syndrome	Hay-Wells syndrome	BEFREE	11159940, 12692135, 12766194, 12932250, 16177572, 16190990, 16258268, 16365259, 16532463, 16679535, 18364388, 19676060, 20738799, 21615690, 21652629 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27034006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29716728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22497596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	30558966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	28595997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypohidrosis	Hypohidrosis	BEFREE	30088137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	19840326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17498688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	20225093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	23665508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	12185332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	23921950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	31187467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	BEFREE	28595997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	28153507, 30719810, 31706671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	12379767		★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	23407076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	28346726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	BEFREE	16691622, 16724007, 17041931, 17224651, 19676060		★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	11462173, 17164413, 23407076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Limbal stem cell deficiency	Limbal stem cell deficiency	BEFREE	21959367, 28758321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23725313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20233581, 28350813, 30643433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31488173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11354544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15551738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36718957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	23665508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37208923	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26332336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	15887287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	17107393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Cystosarcoma Phyllodes	Cystosarcoma Phyllodes	BEFREE	28968268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27034006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	17115439, 29763912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	29048219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12007564, 15849742, 17639392, 19173015, 21363924, 24316488, 24525232, 25893299, 26825981, 27555661, 28349272, 29484502, 31524947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28511869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12447998, 24718831, 29563607, 30181180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	14612504, 15466179, 20332665, 22441934, 25982011, 29751934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23725313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21917857, 23095717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29772221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11956072, 12553000, 14607218, 18781151, 19142959, 22949650, 26990571, 29241741, 29761525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	22249251, 31744230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26406948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	16322335, 17395974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12368193, 22253920, 22361733, 24213852, 28794159, 29956121, 30104251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10618710, 12750249, 14654529, 14689049, 15095006, 15248062, 15280445, 15564824, 15990899, 16084953, 16359856, 16445626, 16462763, 16861923, 16918993 View all (46 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	20442293, 30973901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22155142, 30700826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24316488, 25893299, 26840455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	31831043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	19536621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	19536621		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12429996, 21951600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	30594554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	19400830, 21765392, 31809560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29048219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	17616998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	21777943, 24513264, 29975250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Multiple Acyl-CoA Dehydrogenase Deficiency	BEFREE	31169683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	21269671, 27807867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18813784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37208923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	15564824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10568821, 10769197, 10897041, 11136565, 11358835, 11381365, 11532371, 11592094, 11957139, 12234063, 12358808, 12368193, 12429996, 12434410, 12447998 View all (101 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	19173015, 31132652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10769197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	11381365, 15551738, 28417484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14612504, 21289519, 23064619, 23319821, 28730709, 30798982, 31206846, 31614634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	12185332, 26330357, 26343330, 27060708, 28549030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17568187, 22623071, 25085524		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16445626, 17880529, 23095717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29772221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22053213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	20128632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19493635, 25577570, 29201169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	15489655, 28968268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Poikiloderma of Kindler	Poikiloderma Of Kindler	BEFREE	23278235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	27341130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11956072, 12553000, 14607218, 18781151, 19142959, 22949650, 26990571, 29241741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16417229, 21373745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	19288018		★★★★★ ★☆☆☆☆ Found in Text Mining only
RAPP-HODGKIN SYNDROME	RAPP-HODGKIN SYNDROME	BEFREE	12766194, 15725251, 15807690, 16190990, 16532463, 18364388, 19676060, 22342398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23158209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28129571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rudiger syndrome 1	Rudiger syndrome	BEFREE	10535733, 10839977, 11012604, 11159940, 11462173, 11903230, 11929852, 12161593, 17041931, 18603493, 20180707, 21652629, 21959367, 22056627, 23407076 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	16084953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15489655, 19898465, 29441939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16979518, 30359635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	23589895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	19681128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16512680, 20332665, 25906121, 31263838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	18192965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Split foot	Split Hand Foot Deformity	BEFREE	11787035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	10769197, 11012604, 11462173, 11595015, 11929852, 12164578, 12766194, 14656652, 14699611, 17041931, 22069181, 22342398, 30566872		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPLIT-HAND/FOOT MALFORMATION 3	Split-Hand-Foot Malformation	BEFREE	14699611		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPLIT-HAND/FOOT MALFORMATION 4	Split-Hand-Foot Malformation	BEFREE	16258268, 16861923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11531258, 11727253, 11957139, 12086851, 12358808, 12447998, 12934112, 14562279, 14612504, 15183414, 15201986, 15551738, 16687923, 17018588, 17637751 View all (41 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18333895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	14562279, 19725154, 27029934, 29563607, 30181180, 30538491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31206846, 31551362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	14997391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	24417641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12782800, 15201986, 15564824, 16273222, 16393253, 16885742, 17418619, 17935121, 18087216, 18418053, 19391123, 21088498, 21705376, 28041841, 29162693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	21705376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	27223861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28480888, 28621331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26406948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	BEFREE	17915261		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10769197		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	17880529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	17880529, 30359635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	30359635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16322335, 17395974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12234063, 16322335, 17395974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28488128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	20180707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21252285, 22801492, 28349272, 29484502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	11381365, 25902392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	21965674, 28604778, 28803895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	14654529, 28088268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	11381365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18477895, 27584665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vulvar Lichen Sclerosus	Vulvar Lichen Sclerosus	BEFREE	27223861		★★★★★ ★☆☆☆☆ Found in Text Mining only

CKAP4 (cytoskeleton associated protein 4)