RAB40B (RAB40B, member RAS oncogene family)

Gene

• Entrez ID: 10966
• Gene name: RAB40B, member RAS oncogene family
• Gene symbol: RAB40B
• Synonyms (NCBI Gene): RAR, SEC4L
• Chromosome: 17
• Chromosome location: 17q25.3
• Summary: The protein encoded by this gene has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005841	hsa-miR-204-5p	Luciferase reporter assay, Microarray, qRT-PCR	21282569
MIRT024701	hsa-miR-215-5p	Microarray	19074876
MIRT026754	hsa-miR-192-5p	Microarray	19074876
MIRT030050	hsa-miR-26b-5p	Microarray	19088304
MIRT005841	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	25790780
MIRT005841	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	25790780
MIRT636791	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT636790	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT636789	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT636788	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT636787	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT636786	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT636785	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT147893	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT636784	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT079462	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT636783	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT636782	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT636781	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT636780	hsa-miR-4284	HITS-CLIP	23824327
MIRT636779	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT636778	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT726812	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT726810	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT726811	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT726809	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT636791	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT636790	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT636789	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT636788	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT636787	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT636786	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT636785	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT147893	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT636784	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT079462	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT636783	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT636782	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT636781	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT636780	hsa-miR-4284	HITS-CLIP	23824327
MIRT636779	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT636778	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT1284747	hsa-miR-103a	CLIP-seq
MIRT1284748	hsa-miR-107	CLIP-seq
MIRT1284749	hsa-miR-1179	CLIP-seq
MIRT1284750	hsa-miR-1226	CLIP-seq
MIRT1284751	hsa-miR-1273f	CLIP-seq
MIRT1284752	hsa-miR-143	CLIP-seq
MIRT1284753	hsa-miR-15a	CLIP-seq
MIRT1284754	hsa-miR-15b	CLIP-seq
MIRT1284755	hsa-miR-16	CLIP-seq
MIRT1284756	hsa-miR-195	CLIP-seq
MIRT1284757	hsa-miR-22	CLIP-seq
MIRT1284758	hsa-miR-3125	CLIP-seq
MIRT1284759	hsa-miR-3173-3p	CLIP-seq
MIRT1284760	hsa-miR-3186-5p	CLIP-seq
MIRT1284761	hsa-miR-3200-5p	CLIP-seq
MIRT1284762	hsa-miR-324-5p	CLIP-seq
MIRT1284763	hsa-miR-3914	CLIP-seq
MIRT1284764	hsa-miR-3916	CLIP-seq
MIRT1284765	hsa-miR-3928	CLIP-seq
MIRT1284766	hsa-miR-424	CLIP-seq
MIRT1284767	hsa-miR-4251	CLIP-seq
MIRT1284768	hsa-miR-4310	CLIP-seq
MIRT1284769	hsa-miR-4329	CLIP-seq
MIRT1284770	hsa-miR-4708-5p	CLIP-seq
MIRT1284771	hsa-miR-4770	CLIP-seq
MIRT1284772	hsa-miR-4787-5p	CLIP-seq
MIRT1284773	hsa-miR-489	CLIP-seq
MIRT1284774	hsa-miR-497	CLIP-seq
MIRT1284775	hsa-miR-514	CLIP-seq
MIRT1284776	hsa-miR-514b-3p	CLIP-seq
MIRT1284747	hsa-miR-103a	CLIP-seq
MIRT1284748	hsa-miR-107	CLIP-seq
MIRT1284749	hsa-miR-1179	CLIP-seq
MIRT2084525	hsa-miR-1256	CLIP-seq
MIRT2084526	hsa-miR-1284	CLIP-seq
MIRT1284753	hsa-miR-15a	CLIP-seq
MIRT1284754	hsa-miR-15b	CLIP-seq
MIRT1284755	hsa-miR-16	CLIP-seq
MIRT1284756	hsa-miR-195	CLIP-seq
MIRT2084527	hsa-miR-204	CLIP-seq
MIRT2084528	hsa-miR-211	CLIP-seq
MIRT2084529	hsa-miR-34b	CLIP-seq
MIRT2084530	hsa-miR-3674	CLIP-seq
MIRT1284766	hsa-miR-424	CLIP-seq
MIRT1284768	hsa-miR-4310	CLIP-seq
MIRT2084531	hsa-miR-4642	CLIP-seq
MIRT2084532	hsa-miR-4659a-3p	CLIP-seq
MIRT2084533	hsa-miR-4659b-3p	CLIP-seq
MIRT2084534	hsa-miR-4738-3p	CLIP-seq
MIRT2084535	hsa-miR-4755-5p	CLIP-seq
MIRT2084536	hsa-miR-494	CLIP-seq
MIRT1284774	hsa-miR-497	CLIP-seq
MIRT2084537	hsa-miR-548g	CLIP-seq
MIRT2084538	hsa-miR-623	CLIP-seq
MIRT1284747	hsa-miR-103a	CLIP-seq
MIRT1284748	hsa-miR-107	CLIP-seq
MIRT1284749	hsa-miR-1179	CLIP-seq
MIRT2084525	hsa-miR-1256	CLIP-seq
MIRT2309720	hsa-miR-1271	CLIP-seq
MIRT1284751	hsa-miR-1273f	CLIP-seq
MIRT2309721	hsa-miR-130a	CLIP-seq
MIRT2309722	hsa-miR-130b	CLIP-seq
MIRT2309723	hsa-miR-142-3p	CLIP-seq
MIRT1284752	hsa-miR-143	CLIP-seq
MIRT2309724	hsa-miR-148a	CLIP-seq
MIRT2309725	hsa-miR-148b	CLIP-seq
MIRT2309726	hsa-miR-152	CLIP-seq
MIRT1284753	hsa-miR-15a	CLIP-seq
MIRT1284754	hsa-miR-15b	CLIP-seq
MIRT1284755	hsa-miR-16	CLIP-seq
MIRT2309727	hsa-miR-182	CLIP-seq
MIRT1284756	hsa-miR-195	CLIP-seq
MIRT2309728	hsa-miR-202	CLIP-seq
MIRT2084527	hsa-miR-204	CLIP-seq
MIRT2084528	hsa-miR-211	CLIP-seq
MIRT2309729	hsa-miR-301a	CLIP-seq
MIRT2309730	hsa-miR-301b	CLIP-seq
MIRT1284758	hsa-miR-3125	CLIP-seq
MIRT1284760	hsa-miR-3186-5p	CLIP-seq
MIRT1284761	hsa-miR-3200-5p	CLIP-seq
MIRT2084529	hsa-miR-34b	CLIP-seq
MIRT2309731	hsa-miR-3654	CLIP-seq
MIRT2309732	hsa-miR-3666	CLIP-seq
MIRT1284763	hsa-miR-3914	CLIP-seq
MIRT1284764	hsa-miR-3916	CLIP-seq
MIRT1284765	hsa-miR-3928	CLIP-seq
MIRT1284766	hsa-miR-424	CLIP-seq
MIRT1284767	hsa-miR-4251	CLIP-seq
MIRT2309733	hsa-miR-4295	CLIP-seq
MIRT1284768	hsa-miR-4310	CLIP-seq
MIRT1284769	hsa-miR-4329	CLIP-seq
MIRT2309734	hsa-miR-433	CLIP-seq
MIRT2309735	hsa-miR-4520a-3p	CLIP-seq
MIRT2309736	hsa-miR-454	CLIP-seq
MIRT2309737	hsa-miR-4638-3p	CLIP-seq
MIRT2084531	hsa-miR-4642	CLIP-seq
MIRT2084532	hsa-miR-4659a-3p	CLIP-seq
MIRT2084533	hsa-miR-4659b-3p	CLIP-seq
MIRT1284770	hsa-miR-4708-5p	CLIP-seq
MIRT2309738	hsa-miR-4731-3p	CLIP-seq
MIRT2084535	hsa-miR-4755-5p	CLIP-seq
MIRT1284771	hsa-miR-4770	CLIP-seq
MIRT2309739	hsa-miR-4801	CLIP-seq
MIRT2309740	hsa-miR-485-3p	CLIP-seq
MIRT1284774	hsa-miR-497	CLIP-seq
MIRT2309741	hsa-miR-587	CLIP-seq
MIRT2084538	hsa-miR-623	CLIP-seq
MIRT2309742	hsa-miR-648	CLIP-seq
MIRT2309743	hsa-miR-9	CLIP-seq
MIRT2309744	hsa-miR-96	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001726	Component	Ruffle	IDA	33999101
GO:0001726	Component	Ruffle	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	27789576, 32296183
GO:0005525	Function	GTP binding	IEA
GO:0005635	Component	Nuclear envelope	IDA	22042847
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IBA
GO:0005829	Component	Cytosol	IDA	33999101
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006887	Process	Exocytosis	IBA
GO:0008021	Component	Synaptic vesicle	IBA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IMP	35293963
GO:0016787	Function	Hydrolase activity	IEA
GO:0030027	Component	Lamellipodium	IDA	33999101
GO:0030335	Process	Positive regulation of cell migration	IMP	33999101, 35293963
GO:0031258	Component	Lamellipodium membrane	IDA	35293963
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0032232	Process	Negative regulation of actin filament bundle assembly	IMP	33999101
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	33999101
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	22042847
GO:1902743	Process	Regulation of lamellipodium organization	IMP	33999101
GO:1990748	Process	Cellular detoxification	IMP	22042847
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IMP	33999101, 35293963

Other IDs

• MIM: 619550
• HGNC: 18284
• e!Ensembl: ENSG00000141542

Protein

• UniProt ID: Q12829
• Protein name: Ras-related protein Rab-40B (EC 3.6.5.2) (SOCS box-containing protein RAR) (Protein Rar)
• Protein function: RAB40B small GTPase acts as substrate-recognition components of the ECS(RAB40B) E3 ubiquitin ligase complex which mediates the ubiquitination of target proteins (PubMed:33999101, PubMed:35293963). The Rab40 subfamily belongs to the Rab family th
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	16 → 176	Ras family	Domain
  PF07525	SOCS_box	189 → 225	SOCS box	Domain

• Sequence:

  MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDG
  RRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVP
  KILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGM
  DRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGS
  YSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS

• Sequence length: 278

Pathways

Reactome:

RAB geranylgeranylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	8152281		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10753851, 10800078, 11704848, 15896339, 16504291, 1652369, 7832190, 8152281, 8251913, 8562957, 9207466, 9657734		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11231454		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	23280144		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28944907		★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	16504291		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	15635645		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	15635645		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15635645		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22286019		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	15635645		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10814678, 11141504, 11501579, 17608728, 18592373, 19240236, 20865461, 23902685		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23902685, 35293963	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	15635645		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15080786		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22286019, 22992440		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10717330, 15657432, 19961602		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	9718082		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15526363, 27301432, 30410666		★☆☆☆☆ Found in Text Mining only
Congenital absence of kidney	Renal agenesis	BEFREE	28739660		★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	BEFREE	28739660		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28488270		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15824151, 20426865		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	15824151, 20426865		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	7837930		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	20865461		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27791279		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	15080786		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	17359542	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30496014		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30496014		★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	31264350		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30761678		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	17359542		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10882117	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22510570, 8182938		★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10979971	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11172539, 31822659, 7832190		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22521346, 23474497		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8562957		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	25826424		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10814678, 11141504, 11501579, 17608728, 18592373, 19240236, 20865461, 23902685		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15824151, 20426865		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10717330, 15657432, 19961602, 8950166		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26886237		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25790780		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22286019		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10814678, 15824151, 16849557, 17283134, 20970498		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15064737, 9169003		★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	21254357		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28488270		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	24060638	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23955709		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	24875590		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	8152281		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10814678, 11141504, 11501579, 11945179, 15289362, 15604252, 15766561, 15788661, 17108214, 17549354, 17608728, 17998817, 18592373, 23280144, 23474497, 29471829		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	15526363		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	7786028, 8382032, 9169003		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23969901		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	8152281		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26886237		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31837302		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	29160747		★☆☆☆☆ Found in Text Mining only
RENAL ADYSPLASIA	Renal Aplasia	BEFREE	28739660		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29160747		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15635645		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	19058256		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10415749, 11945179		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17549354		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	7837930		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	17359542		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25790780		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23969901		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29471829	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	15526363		★☆☆☆☆ Found in Text Mining only