STIP1 (stress induced phosphoprotein 1)

Gene

• Entrez ID: 10963
• Gene name: Stress induced phosphoprotein 1
• Gene symbol: STIP1
• Synonyms (NCBI Gene): HEL-S-94n, HOP, IEF-SSP-3521, P60, STI1, STI1L
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substra

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT032016	hsa-miR-16-5p	Proteomics	18668040
MIRT051957	hsa-let-7b-5p	CLASH	23622248
MIRT047040	hsa-miR-183-5p	CLASH	23622248
MIRT044894	hsa-miR-193a-3p	CLASH	23622248
MIRT041679	hsa-miR-484	CLASH	23622248
MIRT035915	hsa-miR-1180-3p	CLASH	23622248
MIRT439523	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439523	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1397117	hsa-miR-1270	CLIP-seq
MIRT1397118	hsa-miR-1827	CLIP-seq
MIRT1397119	hsa-miR-1909	CLIP-seq
MIRT1397120	hsa-miR-3616-3p	CLIP-seq
MIRT1397121	hsa-miR-3960	CLIP-seq
MIRT1397122	hsa-miR-410	CLIP-seq
MIRT1397123	hsa-miR-4434	CLIP-seq
MIRT1397124	hsa-miR-4436b-3p	CLIP-seq
MIRT1397125	hsa-miR-4516	CLIP-seq
MIRT1397126	hsa-miR-4531	CLIP-seq
MIRT1397127	hsa-miR-620	CLIP-seq
MIRT1397128	hsa-miR-885-3p	CLIP-seq
MIRT1397129	hsa-miR-892b	CLIP-seq
MIRT2118878	hsa-miR-1207-3p	CLIP-seq
MIRT1397117	hsa-miR-1270	CLIP-seq
MIRT2118879	hsa-miR-2467-5p	CLIP-seq
MIRT2118880	hsa-miR-3154	CLIP-seq
MIRT2118881	hsa-miR-3179	CLIP-seq
MIRT2118882	hsa-miR-3188	CLIP-seq
MIRT2118883	hsa-miR-3191	CLIP-seq
MIRT2118884	hsa-miR-3649	CLIP-seq
MIRT2118885	hsa-miR-3652	CLIP-seq
MIRT2118886	hsa-miR-3975	CLIP-seq
MIRT2118887	hsa-miR-4430	CLIP-seq
MIRT1397123	hsa-miR-4434	CLIP-seq
MIRT1397125	hsa-miR-4516	CLIP-seq
MIRT1397126	hsa-miR-4531	CLIP-seq
MIRT2118888	hsa-miR-4640-3p	CLIP-seq
MIRT2118889	hsa-miR-4649-3p	CLIP-seq
MIRT2118890	hsa-miR-485-5p	CLIP-seq
MIRT2118891	hsa-miR-492	CLIP-seq
MIRT2118892	hsa-miR-544b	CLIP-seq
MIRT2118893	hsa-miR-568	CLIP-seq
MIRT1397127	hsa-miR-620	CLIP-seq
MIRT2118894	hsa-miR-7	CLIP-seq
MIRT2118878	hsa-miR-1207-3p	CLIP-seq
MIRT1397118	hsa-miR-1827	CLIP-seq
MIRT1397119	hsa-miR-1909	CLIP-seq
MIRT2341250	hsa-miR-2278	CLIP-seq
MIRT2118879	hsa-miR-2467-5p	CLIP-seq
MIRT2341251	hsa-miR-3120-3p	CLIP-seq
MIRT2118882	hsa-miR-3188	CLIP-seq
MIRT2341252	hsa-miR-3192	CLIP-seq
MIRT1397120	hsa-miR-3616-3p	CLIP-seq
MIRT2118884	hsa-miR-3649	CLIP-seq
MIRT2118885	hsa-miR-3652	CLIP-seq
MIRT2341253	hsa-miR-3689a-3p	CLIP-seq
MIRT2341254	hsa-miR-3689c	CLIP-seq
MIRT2341255	hsa-miR-3924	CLIP-seq
MIRT1397121	hsa-miR-3960	CLIP-seq
MIRT2118886	hsa-miR-3975	CLIP-seq
MIRT2118887	hsa-miR-4430	CLIP-seq
MIRT1397124	hsa-miR-4436b-3p	CLIP-seq
MIRT2341256	hsa-miR-4532	CLIP-seq
MIRT2118888	hsa-miR-4640-3p	CLIP-seq
MIRT2118889	hsa-miR-4649-3p	CLIP-seq
MIRT2341257	hsa-miR-4707-5p	CLIP-seq
MIRT2341258	hsa-miR-4709-3p	CLIP-seq
MIRT2341259	hsa-miR-4711-3p	CLIP-seq
MIRT2341260	hsa-miR-4728-5p	CLIP-seq
MIRT2341261	hsa-miR-4731-5p	CLIP-seq
MIRT2341262	hsa-miR-4786-5p	CLIP-seq
MIRT2118890	hsa-miR-485-5p	CLIP-seq
MIRT2118891	hsa-miR-492	CLIP-seq
MIRT2118892	hsa-miR-544b	CLIP-seq
MIRT2341263	hsa-miR-548aa	CLIP-seq
MIRT2341264	hsa-miR-548ac	CLIP-seq
MIRT2341265	hsa-miR-548b-3p	CLIP-seq
MIRT2341266	hsa-miR-548d-3p	CLIP-seq
MIRT2341267	hsa-miR-548z	CLIP-seq
MIRT2118893	hsa-miR-568	CLIP-seq
MIRT2341268	hsa-miR-591	CLIP-seq
MIRT2341269	hsa-miR-593	CLIP-seq
MIRT2118894	hsa-miR-7	CLIP-seq
MIRT1397128	hsa-miR-885-3p	CLIP-seq
MIRT2118878	hsa-miR-1207-3p	CLIP-seq
MIRT2118879	hsa-miR-2467-5p	CLIP-seq
MIRT2118882	hsa-miR-3188	CLIP-seq
MIRT2118884	hsa-miR-3649	CLIP-seq
MIRT2118885	hsa-miR-3652	CLIP-seq
MIRT2118886	hsa-miR-3975	CLIP-seq
MIRT2118887	hsa-miR-4430	CLIP-seq
MIRT2118889	hsa-miR-4649-3p	CLIP-seq
MIRT2118890	hsa-miR-485-5p	CLIP-seq
MIRT2118891	hsa-miR-492	CLIP-seq
MIRT2118892	hsa-miR-544b	CLIP-seq
MIRT2341265	hsa-miR-548b-3p	CLIP-seq
MIRT2118894	hsa-miR-7	CLIP-seq
MIRT2118878	hsa-miR-1207-3p	CLIP-seq
MIRT1397118	hsa-miR-1827	CLIP-seq
MIRT1397119	hsa-miR-1909	CLIP-seq
MIRT2341250	hsa-miR-2278	CLIP-seq
MIRT2118879	hsa-miR-2467-5p	CLIP-seq
MIRT2341251	hsa-miR-3120-3p	CLIP-seq
MIRT2118882	hsa-miR-3188	CLIP-seq
MIRT2635141	hsa-miR-3189-5p	CLIP-seq
MIRT2341252	hsa-miR-3192	CLIP-seq
MIRT1397120	hsa-miR-3616-3p	CLIP-seq
MIRT2118884	hsa-miR-3649	CLIP-seq
MIRT2118885	hsa-miR-3652	CLIP-seq
MIRT2341253	hsa-miR-3689a-3p	CLIP-seq
MIRT2341254	hsa-miR-3689c	CLIP-seq
MIRT1397121	hsa-miR-3960	CLIP-seq
MIRT2118886	hsa-miR-3975	CLIP-seq
MIRT2118887	hsa-miR-4430	CLIP-seq
MIRT1397124	hsa-miR-4436b-3p	CLIP-seq
MIRT2118888	hsa-miR-4640-3p	CLIP-seq
MIRT2118889	hsa-miR-4649-3p	CLIP-seq
MIRT2341258	hsa-miR-4709-3p	CLIP-seq
MIRT2341260	hsa-miR-4728-5p	CLIP-seq
MIRT2341261	hsa-miR-4731-5p	CLIP-seq
MIRT2635142	hsa-miR-4758-3p	CLIP-seq
MIRT2341262	hsa-miR-4786-5p	CLIP-seq
MIRT2118890	hsa-miR-485-5p	CLIP-seq
MIRT2118891	hsa-miR-492	CLIP-seq
MIRT2118892	hsa-miR-544b	CLIP-seq
MIRT2341263	hsa-miR-548aa	CLIP-seq
MIRT2341264	hsa-miR-548ac	CLIP-seq
MIRT2341265	hsa-miR-548b-3p	CLIP-seq
MIRT2341266	hsa-miR-548d-3p	CLIP-seq
MIRT2341267	hsa-miR-548z	CLIP-seq
MIRT2341268	hsa-miR-591	CLIP-seq
MIRT2118894	hsa-miR-7	CLIP-seq
MIRT1397128	hsa-miR-885-3p	CLIP-seq
MIRT2118878	hsa-miR-1207-3p	CLIP-seq
MIRT1397118	hsa-miR-1827	CLIP-seq
MIRT1397119	hsa-miR-1909	CLIP-seq
MIRT2341250	hsa-miR-2278	CLIP-seq
MIRT2118879	hsa-miR-2467-5p	CLIP-seq
MIRT2341251	hsa-miR-3120-3p	CLIP-seq
MIRT2118882	hsa-miR-3188	CLIP-seq
MIRT2635141	hsa-miR-3189-5p	CLIP-seq
MIRT2341252	hsa-miR-3192	CLIP-seq
MIRT1397120	hsa-miR-3616-3p	CLIP-seq
MIRT2118884	hsa-miR-3649	CLIP-seq
MIRT2118885	hsa-miR-3652	CLIP-seq
MIRT2341253	hsa-miR-3689a-3p	CLIP-seq
MIRT2341254	hsa-miR-3689c	CLIP-seq
MIRT1397121	hsa-miR-3960	CLIP-seq
MIRT2118886	hsa-miR-3975	CLIP-seq
MIRT2118887	hsa-miR-4430	CLIP-seq
MIRT1397124	hsa-miR-4436b-3p	CLIP-seq
MIRT2118888	hsa-miR-4640-3p	CLIP-seq
MIRT2118889	hsa-miR-4649-3p	CLIP-seq
MIRT2341258	hsa-miR-4709-3p	CLIP-seq
MIRT2341260	hsa-miR-4728-5p	CLIP-seq
MIRT2341261	hsa-miR-4731-5p	CLIP-seq
MIRT2635142	hsa-miR-4758-3p	CLIP-seq
MIRT2341262	hsa-miR-4786-5p	CLIP-seq
MIRT2118890	hsa-miR-485-5p	CLIP-seq
MIRT2118891	hsa-miR-492	CLIP-seq
MIRT2118892	hsa-miR-544b	CLIP-seq
MIRT2341263	hsa-miR-548aa	CLIP-seq
MIRT2341264	hsa-miR-548ac	CLIP-seq
MIRT2341265	hsa-miR-548b-3p	CLIP-seq
MIRT2341266	hsa-miR-548d-3p	CLIP-seq
MIRT2341267	hsa-miR-548z	CLIP-seq
MIRT2341268	hsa-miR-591	CLIP-seq
MIRT2118894	hsa-miR-7	CLIP-seq
MIRT1397128	hsa-miR-885-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HSF1	Unknown	20692357;22669480

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	20029029, 21044950, 21170051, 21360678, 23349634, 23431407, 24880080, 25036637, 27353360, 28330616, 28514442, 31980649, 32814053, 33961781, 35140242, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	1569099, 16130169
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	TAS	1569099
GO:0005829	Component	Cytosol	TAS
GO:0032991	Component	Protein-containing complex	IDA	23349634
GO:0051879	Function	Hsp90 protein binding	IBA
GO:0051879	Function	Hsp90 protein binding	IPI	29127155
GO:0098761	Process	Cellular response to interleukin-7	IEA
GO:0101031	Component	Protein folding chaperone complex	IDA	29127155
GO:0120293	Component	Dynein axonemal particle	IEA
GO:0120293	Component	Dynein axonemal particle	ISS

Other IDs

• MIM: 605063
• HGNC: 11387
• e!Ensembl: ENSG00000168439

Protein

• UniProt ID: P31948
• Protein name: Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521)
• Protein function: Acts as a co-chaperone for HSP90AA1 (PubMed:27353360). Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90 (By similarity).
• PDB: 1ELR, 1ELW, 2LNI, 2NC9, 3ESK, 3FWV, 7KW7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17830	STI1	130 → 184	STI1 domain	Domain
  PF13181	TPR_8	261 → 291	Tetratricopeptide repeat	Repeat
  PF00515	TPR_1	300 → 332	Tetratricopeptide repeat	Repeat
  PF00515	TPR_1	360 → 393	Tetratricopeptide repeat	Repeat
  PF00515	TPR_1	394 → 427	Tetratricopeptide repeat	Repeat
  PF17830	STI1	482 → 536	STI1 domain	Domain

• Sequence:

  MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYED
  GCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLA
  ERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLS
  VLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKD
  FDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIA
  KAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLA
  LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC
  IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHD
  SPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLI
  AIR

• Sequence length: 543

Pathways

KEGG:

Prion disease

Reactome:

HSP90 chaperone cycle for steroid hormone receptors (SHR)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31819639		★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies	Amyloid neuropathy	Pubtator	24828240	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28559789		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29749828, 31516081		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33208131	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30405858		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	21784300	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	20461751		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31250373		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29103029, 29552132, 29962341, 30211190		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27026610	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30138346	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31250373		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17417779, 24355542		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28199984	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28186972	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20461751, 24488757, 24654750		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29133364		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29265373		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25034945	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8390539		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	21784300	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20617406	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29879402		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22669480, 34890713	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28199984		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31103826		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20534503		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	23273104		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	20410598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	35855056	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	10997688		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	8660983, 8792829		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29673672		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29673672	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29304094, 29673672		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29304094, 29673672	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24488757		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	21850170		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	21850170	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	21850170	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	21850170		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18507846, 31447061		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18507846, 31447061		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17886292		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	31178742		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29285302		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	28406931		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28887036, 29559743, 29596884		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24163084	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30503506		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29103029, 29552132, 29962341, 30211190		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29673672		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30076803		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17417779, 24355542		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20461751, 24654750		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31547977		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29552132, 31222811		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29335007, 29843139		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31250373		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18234960, 22669480, 22824801, 22884369, 23109837, 29304094, 29335007, 29425735, 29843139, 30076803, 30211190, 31547977, 31819639		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	9840926		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	22535842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	31103826		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	31103826	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12411319	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17417779, 18234960, 18507846, 22669480, 22958219, 24488757, 28186972, 28199984, 29103029, 29843139, 30211190, 31103826		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23345134, 28559789		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18751384, 27584082		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20461751, 24654750		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20501939, 23468915, 24654750	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31547977		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29552132, 31222811		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28199984		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	35398354	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18234960, 28186972		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	18234960, 28852266		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20497865	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	17543081		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29335007, 29843139		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29843139	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24163084	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31250373	Associate	★☆☆☆☆ Found in Text Mining only