Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10952
Gene name	SEC61 translocon subunit beta
Gene symbol	SEC61B
Synonyms (NCBI Gene)	-
Chromosome	9
Chromosome location	9q22.33
Summary	The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER mem

Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021708	hsa-miR-133a-3p	Microarray	21396852
MIRT043126	hsa-miR-324-5p	CLASH	23622248
MIRT2323328	hsa-miR-1237	CLIP-seq
MIRT2323329	hsa-miR-1245b-3p	CLIP-seq
MIRT2323330	hsa-miR-1248	CLIP-seq
MIRT2323331	hsa-miR-133a	CLIP-seq
MIRT2323332	hsa-miR-133b	CLIP-seq
MIRT2323333	hsa-miR-3134	CLIP-seq
MIRT2323334	hsa-miR-3942-3p	CLIP-seq
MIRT2323335	hsa-miR-4662a-5p	CLIP-seq
MIRT2323336	hsa-miR-4691-5p	CLIP-seq
MIRT2323337	hsa-miR-4778-3p	CLIP-seq
MIRT2323338	hsa-miR-561	CLIP-seq
MIRT2619182	hsa-miR-3120-3p	CLIP-seq
MIRT2619183	hsa-miR-3161	CLIP-seq
MIRT2619184	hsa-miR-331-3p	CLIP-seq
MIRT2619185	hsa-miR-3607-3p	CLIP-seq
MIRT2619186	hsa-miR-3647-3p	CLIP-seq
MIRT2619187	hsa-miR-371b-5p	CLIP-seq
MIRT2619188	hsa-miR-4275	CLIP-seq
MIRT2619189	hsa-miR-4282	CLIP-seq
MIRT2619190	hsa-miR-4698	CLIP-seq
MIRT2619191	hsa-miR-513a-3p	CLIP-seq
MIRT2619192	hsa-miR-600	CLIP-seq
MIRT2619193	hsa-miR-605	CLIP-seq
MIRT2619194	hsa-miR-944	CLIP-seq
MIRT2619182	hsa-miR-3120-3p	CLIP-seq
MIRT2619183	hsa-miR-3161	CLIP-seq
MIRT2619184	hsa-miR-331-3p	CLIP-seq
MIRT2619185	hsa-miR-3607-3p	CLIP-seq
MIRT2619186	hsa-miR-3647-3p	CLIP-seq
MIRT2619187	hsa-miR-371b-5p	CLIP-seq
MIRT2619188	hsa-miR-4275	CLIP-seq
MIRT2619189	hsa-miR-4282	CLIP-seq
MIRT2619190	hsa-miR-4698	CLIP-seq
MIRT2690336	hsa-miR-4768-5p	CLIP-seq
MIRT2619191	hsa-miR-513a-3p	CLIP-seq
MIRT2619192	hsa-miR-600	CLIP-seq
MIRT2619193	hsa-miR-605	CLIP-seq
MIRT2619194	hsa-miR-944	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005515	Function	Protein binding	IPI	9792704, 17380188, 18555783, 19121997, 19675567, 21866104, 30021884, 32820719, 33845483, 35271311, 36217030
GO:0005783	Component	Endoplasmic reticulum	IDA	18555783
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005784	Component	Sec61 translocon complex	IBA
GO:0005784	Component	Sec61 translocon complex	IDA	31831667
GO:0005784	Component	Sec61 translocon complex	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	27044890
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006616	Process	SRP-dependent cotranslational protein targeting to membrane, translocation	IBA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	22375059
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	8107851
GO:0030970	Process	Retrograde protein transport, ER to cytosol	IMP	17215517
GO:0031204	Process	Post-translational protein targeting to membrane, translocation	IBA
GO:0031205	Component	Endoplasmic reticulum Sec complex	ISS
GO:0036503	Process	ERAD pathway	IDA	8945469
GO:0043022	Function	Ribosome binding	IDA	32820719
GO:0043022	Function	Ribosome binding	IEA
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IDA	17707796
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IEA
GO:0048408	Function	Epidermal growth factor binding	IPI	19602593

MIM	HGNC	e!Ensembl
609214	16993	ENSG00000106803

P60468

Protein name

Protein transport protein Sec61 subunit beta

Protein function

Component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER) (PubMed:12475939). Forms a ribosome receptor and a gated pore in the ER membr

PDB

6W6L , 8B6L , 8DNV , 8DNW , 8DNX , 8DNY , 8DNZ , 8DO0 , 8DO1 , 8DO2 , 8DO3 , 8OJ0 , 8OJ8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03911	Sec61_beta	51 → 91	Sec61beta family	Family

Sequence

MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT
EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Protein export Protein processing in endoplasmic reticulum Phagosome Vibrio cholerae infection		Insertion of tail-anchored proteins into the endoplasmic reticulum membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT POLYCYSTIC LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LIVER DISEASE 1	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	35766008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated polycystic liver disease	Polycystic liver disease	BEFREE	30652979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Kidney disease	Pubtator	36573973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28681934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22710939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24997997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	30135240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Polycystic liver disease	Pubtator	30135240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Polycystic liver disease	BEFREE	30652979		★★★★★ ★☆☆☆☆ Found in Text Mining only

SEC61B (SEC61 translocon subunit beta)