BTG3 (BTG anti-proliferation factor 3)

Gene

• Entrez ID: 10950
• Gene name: BTG anti-proliferation factor 3
• Gene symbol: BTG3
• Synonyms (NCBI Gene): ANA, ANA/BTG3, APRO4, TOB5, TOB55, TOFA
• Chromosome: 21
• Chromosome location: 21q21.1
• Summary: The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019633	hsa-miR-340-5p	Sequencing	20371350
MIRT020163	hsa-miR-130b-3p	Sequencing	20371350
MIRT020477	hsa-miR-106b-5p	Microarray	17242205
MIRT002592	hsa-miR-124-3p	Microarray	18668037
MIRT002592	hsa-miR-124-3p	Microarray	15685193
MIRT028053	hsa-miR-93-5p	Sequencing	20371350
MIRT039982	hsa-miR-615-3p	CLASH	23622248
MIRT039982	hsa-miR-615-3p	CLASH	23622248
MIRT054521	hsa-miR-513a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24252134
MIRT054522	hsa-miR-513b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24252134
MIRT054523	hsa-miR-513c-5p	Luciferase reporter assay, qRT-PCR, Western blot	24252134
MIRT524708	hsa-miR-448	HITS-CLIP	21572407
MIRT524707	hsa-miR-17-5p	HITS-CLIP	21572407
MIRT524706	hsa-miR-20a-5p	HITS-CLIP	21572407
MIRT524705	hsa-miR-106a-5p	HITS-CLIP	21572407
MIRT524704	hsa-miR-526b-3p	HITS-CLIP	21572407
MIRT524703	hsa-miR-519d-3p	HITS-CLIP	21572407
MIRT020477	hsa-miR-106b-5p	HITS-CLIP	21572407
MIRT524702	hsa-miR-20b-5p	HITS-CLIP	21572407
MIRT028053	hsa-miR-93-5p	HITS-CLIP	21572407
MIRT524701	hsa-miR-3609	HITS-CLIP	21572407
MIRT524700	hsa-miR-548ah-5p	HITS-CLIP	21572407
MIRT524699	hsa-miR-4796-3p	HITS-CLIP	21572407
MIRT524698	hsa-miR-519a-3p	HITS-CLIP	21572407
MIRT524697	hsa-miR-519b-3p	HITS-CLIP	21572407
MIRT524696	hsa-miR-519c-3p	HITS-CLIP	21572407
MIRT524695	hsa-miR-4744	HITS-CLIP	21572407
MIRT524694	hsa-miR-4509	HITS-CLIP	21572407
MIRT524693	hsa-miR-3653-3p	HITS-CLIP	21572407
MIRT524692	hsa-miR-3658	HITS-CLIP	21572407
MIRT524691	hsa-miR-7856-5p	HITS-CLIP	21572407
MIRT568241	hsa-miR-548b-3p	PAR-CLIP	20371350
MIRT568240	hsa-miR-4511	PAR-CLIP	20371350
MIRT559134	hsa-miR-8066	PAR-CLIP	20371350
MIRT559133	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT559132	hsa-miR-552-5p	PAR-CLIP	20371350
MIRT559131	hsa-miR-3119	PAR-CLIP	20371350
MIRT507940	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT507938	hsa-miR-3163	PAR-CLIP	20371350
MIRT507939	hsa-miR-8069	PAR-CLIP	20371350
MIRT507937	hsa-miR-3136-3p	PAR-CLIP	20371350
MIRT507936	hsa-miR-7155-3p	PAR-CLIP	20371350
MIRT507935	hsa-miR-5087	PAR-CLIP	20371350
MIRT507934	hsa-miR-328-3p	PAR-CLIP	20371350
MIRT524708	hsa-miR-448	PAR-CLIP	20371350
MIRT524707	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT028053	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT524701	hsa-miR-3609	PAR-CLIP	20371350
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT524695	hsa-miR-4744	PAR-CLIP	20371350
MIRT524694	hsa-miR-4509	PAR-CLIP	20371350
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT524692	hsa-miR-3658	PAR-CLIP	20371350
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT524708	hsa-miR-448	PAR-CLIP	20371350
MIRT524707	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT028053	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT524701	hsa-miR-3609	PAR-CLIP	20371350
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT524695	hsa-miR-4744	PAR-CLIP	20371350
MIRT524694	hsa-miR-4509	PAR-CLIP	20371350
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT524692	hsa-miR-3658	PAR-CLIP	20371350
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT559134	hsa-miR-8066	PAR-CLIP	21572407
MIRT559133	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT559132	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT559131	hsa-miR-3119	PAR-CLIP	21572407
MIRT507940	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT507939	hsa-miR-8069	PAR-CLIP	21572407
MIRT507937	hsa-miR-3136-3p	PAR-CLIP	21572407
MIRT507936	hsa-miR-7155-3p	PAR-CLIP	21572407
MIRT507935	hsa-miR-5087	PAR-CLIP	21572407
MIRT507934	hsa-miR-328-3p	PAR-CLIP	21572407
MIRT524708	hsa-miR-448	PAR-CLIP	21572407
MIRT524707	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT028053	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT524701	hsa-miR-3609	PAR-CLIP	21572407
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT524695	hsa-miR-4744	PAR-CLIP	21572407
MIRT524694	hsa-miR-4509	PAR-CLIP	21572407
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT524692	hsa-miR-3658	PAR-CLIP	21572407
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT507940	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT507938	hsa-miR-3163	PAR-CLIP	21572407
MIRT507939	hsa-miR-8069	PAR-CLIP	21572407
MIRT507937	hsa-miR-3136-3p	PAR-CLIP	21572407
MIRT507936	hsa-miR-7155-3p	PAR-CLIP	21572407
MIRT507935	hsa-miR-5087	PAR-CLIP	21572407
MIRT507934	hsa-miR-328-3p	PAR-CLIP	21572407
MIRT524708	hsa-miR-448	PAR-CLIP	21572407
MIRT524707	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT028053	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT524701	hsa-miR-3609	PAR-CLIP	21572407
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT524695	hsa-miR-4744	PAR-CLIP	21572407
MIRT524694	hsa-miR-4509	PAR-CLIP	21572407
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT524692	hsa-miR-3658	PAR-CLIP	21572407
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT507933	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT084669	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT507932	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT507931	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT507930	hsa-miR-888-5p	PAR-CLIP	21572407
MIRT084666	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT507929	hsa-miR-219a-1-3p	PAR-CLIP	21572407
MIRT524708	hsa-miR-448	PAR-CLIP	22012620
MIRT524707	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT028053	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT524701	hsa-miR-3609	PAR-CLIP	22012620
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	22012620
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT524695	hsa-miR-4744	PAR-CLIP	22012620
MIRT524694	hsa-miR-4509	PAR-CLIP	22012620
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	22012620
MIRT054523	hsa-miR-513c-5p	PAR-CLIP	22012620
MIRT538839	hsa-miR-514b-5p	PAR-CLIP	22012620
MIRT524692	hsa-miR-3658	PAR-CLIP	22012620
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	22012620
MIRT507933	hsa-miR-410-3p	PAR-CLIP	22012620
MIRT084669	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT507932	hsa-miR-338-5p	PAR-CLIP	22012620
MIRT507931	hsa-miR-4797-5p	PAR-CLIP	22012620
MIRT507930	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT084666	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT507929	hsa-miR-219a-1-3p	PAR-CLIP	22012620
MIRT524708	hsa-miR-448	PAR-CLIP	23446348
MIRT524707	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT028053	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT524701	hsa-miR-3609	PAR-CLIP	23446348
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT524695	hsa-miR-4744	PAR-CLIP	23446348
MIRT524694	hsa-miR-4509	PAR-CLIP	23446348
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	23446348
MIRT524692	hsa-miR-3658	PAR-CLIP	23446348
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	23446348
MIRT507940	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT507938	hsa-miR-3163	PAR-CLIP	23446348
MIRT507939	hsa-miR-8069	PAR-CLIP	23446348
MIRT507937	hsa-miR-3136-3p	PAR-CLIP	23446348
MIRT507936	hsa-miR-7155-3p	PAR-CLIP	23446348
MIRT507935	hsa-miR-5087	PAR-CLIP	23446348
MIRT507934	hsa-miR-328-3p	PAR-CLIP	23446348
MIRT507933	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT084669	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT507932	hsa-miR-338-5p	PAR-CLIP	23446348
MIRT507931	hsa-miR-4797-5p	PAR-CLIP	23446348
MIRT507930	hsa-miR-888-5p	PAR-CLIP	23446348
MIRT084666	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT507929	hsa-miR-219a-1-3p	PAR-CLIP	23446348
MIRT496867	hsa-miR-8063	PAR-CLIP	22291592
MIRT496866	hsa-miR-4698	PAR-CLIP	22291592
MIRT524705	hsa-miR-106a-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	32627648
MIRT524708	hsa-miR-448	HITS-CLIP	21572407
MIRT524707	hsa-miR-17-5p	HITS-CLIP	21572407
MIRT524706	hsa-miR-20a-5p	HITS-CLIP	21572407
MIRT524705	hsa-miR-106a-5p	HITS-CLIP	21572407
MIRT524704	hsa-miR-526b-3p	HITS-CLIP	21572407
MIRT524703	hsa-miR-519d-3p	HITS-CLIP	21572407
MIRT020477	hsa-miR-106b-5p	HITS-CLIP	21572407
MIRT524702	hsa-miR-20b-5p	HITS-CLIP	21572407
MIRT028053	hsa-miR-93-5p	HITS-CLIP	21572407
MIRT524701	hsa-miR-3609	HITS-CLIP	21572407
MIRT524700	hsa-miR-548ah-5p	HITS-CLIP	21572407
MIRT524699	hsa-miR-4796-3p	HITS-CLIP	21572407
MIRT524698	hsa-miR-519a-3p	HITS-CLIP	21572407
MIRT524697	hsa-miR-519b-3p	HITS-CLIP	21572407
MIRT524696	hsa-miR-519c-3p	HITS-CLIP	21572407
MIRT524695	hsa-miR-4744	HITS-CLIP	21572407
MIRT524694	hsa-miR-4509	HITS-CLIP	21572407
MIRT524693	hsa-miR-3653-3p	HITS-CLIP	21572407
MIRT524692	hsa-miR-3658	HITS-CLIP	21572407
MIRT524691	hsa-miR-7856-5p	HITS-CLIP	21572407
MIRT568241	hsa-miR-548b-3p	PAR-CLIP	20371350
MIRT568240	hsa-miR-4511	PAR-CLIP	20371350
MIRT559134	hsa-miR-8066	PAR-CLIP	20371350
MIRT559133	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT559132	hsa-miR-552-5p	PAR-CLIP	20371350
MIRT559131	hsa-miR-3119	PAR-CLIP	20371350
MIRT507940	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT507938	hsa-miR-3163	PAR-CLIP	20371350
MIRT507939	hsa-miR-8069	PAR-CLIP	20371350
MIRT507937	hsa-miR-3136-3p	PAR-CLIP	20371350
MIRT507936	hsa-miR-7155-3p	PAR-CLIP	20371350
MIRT507935	hsa-miR-5087	PAR-CLIP	20371350
MIRT507934	hsa-miR-328-3p	PAR-CLIP	20371350
MIRT524708	hsa-miR-448	PAR-CLIP	20371350
MIRT524707	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT028053	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT524701	hsa-miR-3609	PAR-CLIP	20371350
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT524695	hsa-miR-4744	PAR-CLIP	20371350
MIRT524694	hsa-miR-4509	PAR-CLIP	20371350
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT524692	hsa-miR-3658	PAR-CLIP	20371350
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT524708	hsa-miR-448	PAR-CLIP	20371350
MIRT524707	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT028053	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT524701	hsa-miR-3609	PAR-CLIP	20371350
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT524695	hsa-miR-4744	PAR-CLIP	20371350
MIRT524694	hsa-miR-4509	PAR-CLIP	20371350
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT524692	hsa-miR-3658	PAR-CLIP	20371350
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT559134	hsa-miR-8066	PAR-CLIP	21572407
MIRT559133	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT559132	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT559131	hsa-miR-3119	PAR-CLIP	21572407
MIRT507940	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT507939	hsa-miR-8069	PAR-CLIP	21572407
MIRT507937	hsa-miR-3136-3p	PAR-CLIP	21572407
MIRT507936	hsa-miR-7155-3p	PAR-CLIP	21572407
MIRT507935	hsa-miR-5087	PAR-CLIP	21572407
MIRT507934	hsa-miR-328-3p	PAR-CLIP	21572407
MIRT524708	hsa-miR-448	PAR-CLIP	21572407
MIRT524707	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT028053	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT524701	hsa-miR-3609	PAR-CLIP	21572407
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT524695	hsa-miR-4744	PAR-CLIP	21572407
MIRT524694	hsa-miR-4509	PAR-CLIP	21572407
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT524692	hsa-miR-3658	PAR-CLIP	21572407
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT507940	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT507938	hsa-miR-3163	PAR-CLIP	21572407
MIRT507939	hsa-miR-8069	PAR-CLIP	21572407
MIRT507937	hsa-miR-3136-3p	PAR-CLIP	21572407
MIRT507936	hsa-miR-7155-3p	PAR-CLIP	21572407
MIRT507935	hsa-miR-5087	PAR-CLIP	21572407
MIRT507934	hsa-miR-328-3p	PAR-CLIP	21572407
MIRT524708	hsa-miR-448	PAR-CLIP	21572407
MIRT524707	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT028053	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT524701	hsa-miR-3609	PAR-CLIP	21572407
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT524695	hsa-miR-4744	PAR-CLIP	21572407
MIRT524694	hsa-miR-4509	PAR-CLIP	21572407
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT524692	hsa-miR-3658	PAR-CLIP	21572407
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT507933	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT084669	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT507932	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT507931	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT507930	hsa-miR-888-5p	PAR-CLIP	21572407
MIRT084666	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT507929	hsa-miR-219a-1-3p	PAR-CLIP	21572407
MIRT524708	hsa-miR-448	PAR-CLIP	22012620
MIRT524707	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT028053	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT524701	hsa-miR-3609	PAR-CLIP	22012620
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	22012620
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT524695	hsa-miR-4744	PAR-CLIP	22012620
MIRT524694	hsa-miR-4509	PAR-CLIP	22012620
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	22012620
MIRT054523	hsa-miR-513c-5p	PAR-CLIP	22012620
MIRT538839	hsa-miR-514b-5p	PAR-CLIP	22012620
MIRT524692	hsa-miR-3658	PAR-CLIP	22012620
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	22012620
MIRT507933	hsa-miR-410-3p	PAR-CLIP	22012620
MIRT084669	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT507932	hsa-miR-338-5p	PAR-CLIP	22012620
MIRT507931	hsa-miR-4797-5p	PAR-CLIP	22012620
MIRT507930	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT084666	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT507929	hsa-miR-219a-1-3p	PAR-CLIP	22012620
MIRT524708	hsa-miR-448	PAR-CLIP	23446348
MIRT524707	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT524706	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT524705	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT524704	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT524703	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT020477	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT524702	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT028053	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT524701	hsa-miR-3609	PAR-CLIP	23446348
MIRT524700	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT524699	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT524698	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT524697	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT524696	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT524695	hsa-miR-4744	PAR-CLIP	23446348
MIRT524694	hsa-miR-4509	PAR-CLIP	23446348
MIRT524693	hsa-miR-3653-3p	PAR-CLIP	23446348
MIRT524692	hsa-miR-3658	PAR-CLIP	23446348
MIRT524691	hsa-miR-7856-5p	PAR-CLIP	23446348
MIRT507940	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT507938	hsa-miR-3163	PAR-CLIP	23446348
MIRT507939	hsa-miR-8069	PAR-CLIP	23446348
MIRT507937	hsa-miR-3136-3p	PAR-CLIP	23446348
MIRT507936	hsa-miR-7155-3p	PAR-CLIP	23446348
MIRT507935	hsa-miR-5087	PAR-CLIP	23446348
MIRT507934	hsa-miR-328-3p	PAR-CLIP	23446348
MIRT507933	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT084669	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT507932	hsa-miR-338-5p	PAR-CLIP	23446348
MIRT507931	hsa-miR-4797-5p	PAR-CLIP	23446348
MIRT507930	hsa-miR-888-5p	PAR-CLIP	23446348
MIRT084666	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT507929	hsa-miR-219a-1-3p	PAR-CLIP	23446348
MIRT496867	hsa-miR-8063	PAR-CLIP	22291592
MIRT496866	hsa-miR-4698	PAR-CLIP	22291592
MIRT1944798	hsa-miR-139-5p	CLIP-seq
MIRT1944799	hsa-miR-2117	CLIP-seq
MIRT1944800	hsa-miR-323b-3p	CLIP-seq
MIRT1944801	hsa-miR-377	CLIP-seq
MIRT1944802	hsa-miR-410	CLIP-seq
MIRT1944803	hsa-miR-4255	CLIP-seq
MIRT1944804	hsa-miR-4273	CLIP-seq
MIRT1944805	hsa-miR-4436b-5p	CLIP-seq
MIRT1944806	hsa-miR-450b-5p	CLIP-seq
MIRT1944807	hsa-miR-4753-3p	CLIP-seq
MIRT1944808	hsa-miR-888	CLIP-seq
MIRT1944809	hsa-miR-891b	CLIP-seq
MIRT1944798	hsa-miR-139-5p	CLIP-seq
MIRT1944799	hsa-miR-2117	CLIP-seq
MIRT2183241	hsa-miR-219-1-3p	CLIP-seq
MIRT1944802	hsa-miR-410	CLIP-seq
MIRT1944803	hsa-miR-4255	CLIP-seq
MIRT1944804	hsa-miR-4273	CLIP-seq
MIRT1944805	hsa-miR-4436b-5p	CLIP-seq
MIRT2183241	hsa-miR-219-1-3p	CLIP-seq
MIRT2384904	hsa-miR-3121-3p	CLIP-seq
MIRT1944802	hsa-miR-410	CLIP-seq
MIRT2384904	hsa-miR-3121-3p	CLIP-seq
MIRT1944801	hsa-miR-377	CLIP-seq
MIRT1944807	hsa-miR-4753-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TP53	Unknown	18590053

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17690688
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9632145
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9632145
GO:0045930	Process	Negative regulation of mitotic cell cycle	IDA	9632145

Other IDs

• MIM: 605674
• HGNC: 1132
• e!Ensembl: ENSG00000154640

Protein

• UniProt ID: Q14201
• Protein name: Protein BTG3 (Abundant in neuroepithelium area protein) (BTG family member 3) (Protein Tob5)
• Protein function: Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07742	BTG	1 → 115	BTG family	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung. {ECO:0000269|PubMed:9067576}.
• Sequence:

  MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCI
  RVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENK
  DENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFP
  PLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDR
  NHWINPHMLAPH

• Sequence length: 252

Pathways

KEGG:

RNA degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC KETOACIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	25701359		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10232601		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	26614346, 31297057		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	30807792		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	BEFREE	30942895		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	31250384		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	23657964, 25904053		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29854827		★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	30807792		★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	BEFREE	15703957		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28257759, 9194920		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28257759, 9194920		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19151116, 27681518		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18283522, 35045800	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	31422415		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22554526, 28337446, 29615791, 31069155, 31478595		★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	27476469		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	27476469		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27476469		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	23657964		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18590053	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18590053	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23419616, 23533280, 23657964, 28407690	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24147003	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19068083, 23810394, 9523199		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23657964	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19221000	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23419616, 23657964, 28183228		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28656112, 30311496		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28399926, 29855617		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28399926, 29855617		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	26614346, 31297057		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	27989131		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	19221000		★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	29703151		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	19221000		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27468874, 28407690, 29270670, 31058532		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28407690	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29270670	Inhibit	★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	19482442		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19221000		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	19221000		★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	27476469		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	30807792		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27646315		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27646315		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	29294089		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	18590053	Inhibit	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28183228		★☆☆☆☆ Found in Text Mining only
Erythema Multiforme	Erythema	BEFREE	31674268		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30702111		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30702111		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	25701359		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	38154829	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27476469		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	31422415	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	30452329		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29258102		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30086367		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	16807696, 29732713		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	26465327	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	19221000	Inhibit	★☆☆☆☆ Found in Text Mining only
Linear Scleroderma	Linear Scleroderma	BEFREE	16368732		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	11259088, 31704818		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24147003, 31387005		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	28951708		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29294089, 30807792		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	9523199		★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	31076830, 31326291		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15540512, 30837156, 3955897, 8162472		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21554754, 24741342, 26867643, 27059652, 29180749	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22620859	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15540512, 30837156, 8162472		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15540512, 19151116, 21078628, 27831535, 28526593, 28862243, 29258102, 29615791, 30742448, 30837156, 30875459, 314291, 31478595, 31674268, 31722604, 334183, 6392551, 8162472		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15540512, 30837156, 8162472		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	29854827		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30702111		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19068083, 23419616, 23810394, 9523199		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	11259088, 31704818		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23419616, 23657964		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19885928, 22020331		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25238703, 25904053		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19221000, 19885928, 23657964, 23810394, 25904053, 31069155		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28399926, 29855617		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	26614346, 31297057		★☆☆☆☆ Found in Text Mining only
Morphea	Morphea	BEFREE	28951708		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	11259088	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11259088, 19221000, 19885928, 22020331, 23533280, 23810394, 24147003, 25238703, 25701359, 28407690, 29270670, 30702111		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	8162472		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30807792		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23810394, 29197876, 31289482		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29323740		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23419616, 23657964		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	23419616		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23419616	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	19221000		★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	29703151		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	14687829, 30807792		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	30807792		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19885928, 22020331		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19885928	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23419616	Inhibit	★☆☆☆☆ Found in Text Mining only
PSORIASIS 2	Psoriasis	BEFREE	27476469		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33680092	Associate	★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	29667101		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19221000		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	19221000		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30807792		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22750227, 27831535, 30452329, 30807792, 6601712		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	19221000		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	29294089, 30452329		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33680092	Associate	★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	22622038	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	18283522	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27693630		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25238703, 25904053		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28749191, 28807021, 29294089, 29703151, 30452329, 30807792, 31069155, 7979601		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28552529		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37904215	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	29732713		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31088420		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30942895, 8162472		★☆☆☆☆ Found in Text Mining only