PRDX3 (peroxiredoxin 3)

Gene

• Entrez ID: 10935
• Gene name: Peroxiredoxin 3
• Gene symbol: PRDX3
• Synonyms (NCBI Gene): AOP-1, AOP1, HBC189, MER5, PPPCD, PRO1748, SCAR32, SP-22, prx-III
• Chromosome: 10
• Chromosome location: 10q26.11
• Summary: This gene encodes a mitochondrial protein with antioxidant function. The protein is similar to the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase, and it can rescue bacterial resistance to alkylhydroperoxide in E. coli that lack the C2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007305	hsa-miR-383-5p	Luciferase reporter assay	23227829
MIRT007305	hsa-miR-383-5p	Luciferase reporter assay	23227829
MIRT016299	hsa-miR-193b-3p	Proteomics	21512034
MIRT019731	hsa-miR-375	Microarray	20215506
MIRT025072	hsa-miR-181a-5p	Microarray	17612493
MIRT051339	hsa-miR-15a-5p	CLASH	23622248
MIRT046524	hsa-miR-15b-5p	CLASH	23622248
MIRT044454	hsa-miR-320a	CLASH	23622248
MIRT506046	hsa-miR-362-5p	HITS-CLIP	21572407
MIRT506045	hsa-miR-500b-5p	HITS-CLIP	21572407
MIRT506044	hsa-miR-501-5p	HITS-CLIP	21572407
MIRT506043	hsa-miR-4308	HITS-CLIP	21572407
MIRT506042	hsa-miR-4292	HITS-CLIP	21572407
MIRT506041	hsa-miR-6791-5p	HITS-CLIP	21572407
MIRT506040	hsa-miR-378j	HITS-CLIP	21572407
MIRT506039	hsa-miR-6839-5p	HITS-CLIP	21572407
MIRT506038	hsa-miR-3167	HITS-CLIP	21572407
MIRT506037	hsa-miR-876-5p	HITS-CLIP	21572407
MIRT506036	hsa-miR-1290	HITS-CLIP	21572407
MIRT506035	hsa-miR-3161	HITS-CLIP	21572407
MIRT506034	hsa-miR-599	HITS-CLIP	21572407
MIRT506046	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT506044	hsa-miR-501-5p	PAR-CLIP	20371350
MIRT506043	hsa-miR-4308	PAR-CLIP	20371350
MIRT506042	hsa-miR-4292	PAR-CLIP	20371350
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT506040	hsa-miR-378j	PAR-CLIP	20371350
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT506038	hsa-miR-3167	PAR-CLIP	20371350
MIRT506037	hsa-miR-876-5p	PAR-CLIP	20371350
MIRT506036	hsa-miR-1290	PAR-CLIP	20371350
MIRT555257	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT555256	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT506035	hsa-miR-3161	PAR-CLIP	20371350
MIRT506034	hsa-miR-599	PAR-CLIP	20371350
MIRT506046	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT506044	hsa-miR-501-5p	PAR-CLIP	20371350
MIRT506043	hsa-miR-4308	PAR-CLIP	20371350
MIRT506042	hsa-miR-4292	PAR-CLIP	20371350
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT506040	hsa-miR-378j	PAR-CLIP	20371350
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT506038	hsa-miR-3167	PAR-CLIP	20371350
MIRT506037	hsa-miR-876-5p	PAR-CLIP	20371350
MIRT506036	hsa-miR-1290	PAR-CLIP	20371350
MIRT506035	hsa-miR-3161	PAR-CLIP	20371350
MIRT506034	hsa-miR-599	PAR-CLIP	20371350
MIRT506046	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT506044	hsa-miR-501-5p	PAR-CLIP	20371350
MIRT506043	hsa-miR-4308	PAR-CLIP	20371350
MIRT506042	hsa-miR-4292	PAR-CLIP	20371350
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT506040	hsa-miR-378j	PAR-CLIP	20371350
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT506038	hsa-miR-3167	PAR-CLIP	20371350
MIRT506037	hsa-miR-876-5p	PAR-CLIP	20371350
MIRT506036	hsa-miR-1290	PAR-CLIP	20371350
MIRT506035	hsa-miR-3161	PAR-CLIP	20371350
MIRT506034	hsa-miR-599	PAR-CLIP	20371350
MIRT506046	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT506044	hsa-miR-501-5p	PAR-CLIP	20371350
MIRT521703	hsa-miR-4698	PAR-CLIP	20371350
MIRT506043	hsa-miR-4308	PAR-CLIP	20371350
MIRT506042	hsa-miR-4292	PAR-CLIP	20371350
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT506040	hsa-miR-378j	PAR-CLIP	20371350
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT506038	hsa-miR-3167	PAR-CLIP	20371350
MIRT506037	hsa-miR-876-5p	PAR-CLIP	20371350
MIRT506036	hsa-miR-1290	PAR-CLIP	20371350
MIRT555257	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT555256	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT506035	hsa-miR-3161	PAR-CLIP	20371350
MIRT506034	hsa-miR-599	PAR-CLIP	20371350
MIRT506046	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT506044	hsa-miR-501-5p	PAR-CLIP	20371350
MIRT506043	hsa-miR-4308	PAR-CLIP	20371350
MIRT506042	hsa-miR-4292	PAR-CLIP	20371350
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT506040	hsa-miR-378j	PAR-CLIP	20371350
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT506038	hsa-miR-3167	PAR-CLIP	20371350
MIRT506037	hsa-miR-876-5p	PAR-CLIP	20371350
MIRT506036	hsa-miR-1290	PAR-CLIP	20371350
MIRT506035	hsa-miR-3161	PAR-CLIP	20371350
MIRT506034	hsa-miR-599	PAR-CLIP	20371350
MIRT506046	hsa-miR-362-5p	PAR-CLIP	21572407
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	21572407
MIRT506044	hsa-miR-501-5p	PAR-CLIP	21572407
MIRT521704	hsa-miR-8063	PAR-CLIP	21572407
MIRT521703	hsa-miR-4698	PAR-CLIP	21572407
MIRT506043	hsa-miR-4308	PAR-CLIP	21572407
MIRT506042	hsa-miR-4292	PAR-CLIP	21572407
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	21572407
MIRT506040	hsa-miR-378j	PAR-CLIP	21572407
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	21572407
MIRT506038	hsa-miR-3167	PAR-CLIP	21572407
MIRT506037	hsa-miR-876-5p	PAR-CLIP	21572407
MIRT506036	hsa-miR-1290	PAR-CLIP	21572407
MIRT555257	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT555256	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT506035	hsa-miR-3161	PAR-CLIP	21572407
MIRT521702	hsa-miR-607	PAR-CLIP	21572407
MIRT506034	hsa-miR-599	PAR-CLIP	21572407
MIRT506046	hsa-miR-362-5p	PAR-CLIP	21572407
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	21572407
MIRT506044	hsa-miR-501-5p	PAR-CLIP	21572407
MIRT506043	hsa-miR-4308	PAR-CLIP	21572407
MIRT506042	hsa-miR-4292	PAR-CLIP	21572407
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	21572407
MIRT506040	hsa-miR-378j	PAR-CLIP	21572407
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	21572407
MIRT506038	hsa-miR-3167	PAR-CLIP	21572407
MIRT506037	hsa-miR-876-5p	PAR-CLIP	21572407
MIRT506036	hsa-miR-1290	PAR-CLIP	21572407
MIRT506035	hsa-miR-3161	PAR-CLIP	21572407
MIRT506034	hsa-miR-599	PAR-CLIP	21572407
MIRT521706	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT521705	hsa-miR-3163	PAR-CLIP	23446348
MIRT506046	hsa-miR-362-5p	PAR-CLIP	23446348
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	23446348
MIRT506044	hsa-miR-501-5p	PAR-CLIP	23446348
MIRT521704	hsa-miR-8063	PAR-CLIP	23446348
MIRT521703	hsa-miR-4698	PAR-CLIP	23446348
MIRT506043	hsa-miR-4308	PAR-CLIP	23446348
MIRT506042	hsa-miR-4292	PAR-CLIP	23446348
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	23446348
MIRT506040	hsa-miR-378j	PAR-CLIP	23446348
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	23446348
MIRT506038	hsa-miR-3167	PAR-CLIP	23446348
MIRT506037	hsa-miR-876-5p	PAR-CLIP	23446348
MIRT506036	hsa-miR-1290	PAR-CLIP	23446348
MIRT506035	hsa-miR-3161	PAR-CLIP	23446348
MIRT521702	hsa-miR-607	PAR-CLIP	23446348
MIRT506034	hsa-miR-599	PAR-CLIP	23446348
MIRT506046	hsa-miR-362-5p	PAR-CLIP	23446348
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	23446348
MIRT506044	hsa-miR-501-5p	PAR-CLIP	23446348
MIRT506043	hsa-miR-4308	PAR-CLIP	23446348
MIRT506042	hsa-miR-4292	PAR-CLIP	23446348
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	23446348
MIRT506040	hsa-miR-378j	PAR-CLIP	23446348
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	23446348
MIRT506038	hsa-miR-3167	PAR-CLIP	23446348
MIRT506037	hsa-miR-876-5p	PAR-CLIP	23446348
MIRT506036	hsa-miR-1290	PAR-CLIP	23446348
MIRT506035	hsa-miR-3161	PAR-CLIP	23446348
MIRT506034	hsa-miR-599	PAR-CLIP	23446348
MIRT506046	hsa-miR-362-5p	PAR-CLIP	23446348
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	23446348
MIRT506044	hsa-miR-501-5p	PAR-CLIP	23446348
MIRT506043	hsa-miR-4308	PAR-CLIP	23446348
MIRT506042	hsa-miR-4292	PAR-CLIP	23446348
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	23446348
MIRT506040	hsa-miR-378j	PAR-CLIP	23446348
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	23446348
MIRT506038	hsa-miR-3167	PAR-CLIP	23446348
MIRT506037	hsa-miR-876-5p	PAR-CLIP	23446348
MIRT506036	hsa-miR-1290	PAR-CLIP	23446348
MIRT506035	hsa-miR-3161	PAR-CLIP	23446348
MIRT506034	hsa-miR-599	PAR-CLIP	23446348
MIRT732784	hsa-miR-383-3p	qRT-PCR, Western blotting	33747176
MIRT506046	hsa-miR-362-5p	HITS-CLIP	21572407
MIRT506045	hsa-miR-500b-5p	HITS-CLIP	21572407
MIRT506044	hsa-miR-501-5p	HITS-CLIP	21572407
MIRT506043	hsa-miR-4308	HITS-CLIP	21572407
MIRT506042	hsa-miR-4292	HITS-CLIP	21572407
MIRT506041	hsa-miR-6791-5p	HITS-CLIP	21572407
MIRT506040	hsa-miR-378j	HITS-CLIP	21572407
MIRT506039	hsa-miR-6839-5p	HITS-CLIP	21572407
MIRT506038	hsa-miR-3167	HITS-CLIP	21572407
MIRT506037	hsa-miR-876-5p	HITS-CLIP	21572407
MIRT506036	hsa-miR-1290	HITS-CLIP	21572407
MIRT506035	hsa-miR-3161	HITS-CLIP	21572407
MIRT506034	hsa-miR-599	HITS-CLIP	21572407
MIRT506046	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT506044	hsa-miR-501-5p	PAR-CLIP	20371350
MIRT506043	hsa-miR-4308	PAR-CLIP	20371350
MIRT506042	hsa-miR-4292	PAR-CLIP	20371350
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT506040	hsa-miR-378j	PAR-CLIP	20371350
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT506038	hsa-miR-3167	PAR-CLIP	20371350
MIRT506037	hsa-miR-876-5p	PAR-CLIP	20371350
MIRT506036	hsa-miR-1290	PAR-CLIP	20371350
MIRT555257	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT555256	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT506035	hsa-miR-3161	PAR-CLIP	20371350
MIRT506034	hsa-miR-599	PAR-CLIP	20371350
MIRT506046	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT506044	hsa-miR-501-5p	PAR-CLIP	20371350
MIRT506043	hsa-miR-4308	PAR-CLIP	20371350
MIRT506042	hsa-miR-4292	PAR-CLIP	20371350
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT506040	hsa-miR-378j	PAR-CLIP	20371350
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT506038	hsa-miR-3167	PAR-CLIP	20371350
MIRT506037	hsa-miR-876-5p	PAR-CLIP	20371350
MIRT506036	hsa-miR-1290	PAR-CLIP	20371350
MIRT506035	hsa-miR-3161	PAR-CLIP	20371350
MIRT506034	hsa-miR-599	PAR-CLIP	20371350
MIRT506046	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT506044	hsa-miR-501-5p	PAR-CLIP	20371350
MIRT506043	hsa-miR-4308	PAR-CLIP	20371350
MIRT506042	hsa-miR-4292	PAR-CLIP	20371350
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT506040	hsa-miR-378j	PAR-CLIP	20371350
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT506038	hsa-miR-3167	PAR-CLIP	20371350
MIRT506037	hsa-miR-876-5p	PAR-CLIP	20371350
MIRT506036	hsa-miR-1290	PAR-CLIP	20371350
MIRT506035	hsa-miR-3161	PAR-CLIP	20371350
MIRT506034	hsa-miR-599	PAR-CLIP	20371350
MIRT506046	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT506044	hsa-miR-501-5p	PAR-CLIP	20371350
MIRT521703	hsa-miR-4698	PAR-CLIP	20371350
MIRT506043	hsa-miR-4308	PAR-CLIP	20371350
MIRT506042	hsa-miR-4292	PAR-CLIP	20371350
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT506040	hsa-miR-378j	PAR-CLIP	20371350
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT506038	hsa-miR-3167	PAR-CLIP	20371350
MIRT506037	hsa-miR-876-5p	PAR-CLIP	20371350
MIRT506036	hsa-miR-1290	PAR-CLIP	20371350
MIRT555257	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT555256	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT506035	hsa-miR-3161	PAR-CLIP	20371350
MIRT506034	hsa-miR-599	PAR-CLIP	20371350
MIRT506046	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT506044	hsa-miR-501-5p	PAR-CLIP	20371350
MIRT506043	hsa-miR-4308	PAR-CLIP	20371350
MIRT506042	hsa-miR-4292	PAR-CLIP	20371350
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT506040	hsa-miR-378j	PAR-CLIP	20371350
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT506038	hsa-miR-3167	PAR-CLIP	20371350
MIRT506037	hsa-miR-876-5p	PAR-CLIP	20371350
MIRT506036	hsa-miR-1290	PAR-CLIP	20371350
MIRT506035	hsa-miR-3161	PAR-CLIP	20371350
MIRT506034	hsa-miR-599	PAR-CLIP	20371350
MIRT506046	hsa-miR-362-5p	PAR-CLIP	21572407
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	21572407
MIRT506044	hsa-miR-501-5p	PAR-CLIP	21572407
MIRT521704	hsa-miR-8063	PAR-CLIP	21572407
MIRT521703	hsa-miR-4698	PAR-CLIP	21572407
MIRT506043	hsa-miR-4308	PAR-CLIP	21572407
MIRT506042	hsa-miR-4292	PAR-CLIP	21572407
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	21572407
MIRT506040	hsa-miR-378j	PAR-CLIP	21572407
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	21572407
MIRT506038	hsa-miR-3167	PAR-CLIP	21572407
MIRT506037	hsa-miR-876-5p	PAR-CLIP	21572407
MIRT506036	hsa-miR-1290	PAR-CLIP	21572407
MIRT555257	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT555256	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT506035	hsa-miR-3161	PAR-CLIP	21572407
MIRT521702	hsa-miR-607	PAR-CLIP	21572407
MIRT506034	hsa-miR-599	PAR-CLIP	21572407
MIRT506046	hsa-miR-362-5p	PAR-CLIP	21572407
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	21572407
MIRT506044	hsa-miR-501-5p	PAR-CLIP	21572407
MIRT506043	hsa-miR-4308	PAR-CLIP	21572407
MIRT506042	hsa-miR-4292	PAR-CLIP	21572407
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	21572407
MIRT506040	hsa-miR-378j	PAR-CLIP	21572407
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	21572407
MIRT506038	hsa-miR-3167	PAR-CLIP	21572407
MIRT506037	hsa-miR-876-5p	PAR-CLIP	21572407
MIRT506036	hsa-miR-1290	PAR-CLIP	21572407
MIRT506035	hsa-miR-3161	PAR-CLIP	21572407
MIRT506034	hsa-miR-599	PAR-CLIP	21572407
MIRT521706	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT521705	hsa-miR-3163	PAR-CLIP	23446348
MIRT506046	hsa-miR-362-5p	PAR-CLIP	23446348
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	23446348
MIRT506044	hsa-miR-501-5p	PAR-CLIP	23446348
MIRT521704	hsa-miR-8063	PAR-CLIP	23446348
MIRT521703	hsa-miR-4698	PAR-CLIP	23446348
MIRT506043	hsa-miR-4308	PAR-CLIP	23446348
MIRT506042	hsa-miR-4292	PAR-CLIP	23446348
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	23446348
MIRT506040	hsa-miR-378j	PAR-CLIP	23446348
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	23446348
MIRT506038	hsa-miR-3167	PAR-CLIP	23446348
MIRT506037	hsa-miR-876-5p	PAR-CLIP	23446348
MIRT506036	hsa-miR-1290	PAR-CLIP	23446348
MIRT506035	hsa-miR-3161	PAR-CLIP	23446348
MIRT521702	hsa-miR-607	PAR-CLIP	23446348
MIRT506034	hsa-miR-599	PAR-CLIP	23446348
MIRT506046	hsa-miR-362-5p	PAR-CLIP	23446348
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	23446348
MIRT506044	hsa-miR-501-5p	PAR-CLIP	23446348
MIRT506043	hsa-miR-4308	PAR-CLIP	23446348
MIRT506042	hsa-miR-4292	PAR-CLIP	23446348
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	23446348
MIRT506040	hsa-miR-378j	PAR-CLIP	23446348
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	23446348
MIRT506038	hsa-miR-3167	PAR-CLIP	23446348
MIRT506037	hsa-miR-876-5p	PAR-CLIP	23446348
MIRT506036	hsa-miR-1290	PAR-CLIP	23446348
MIRT506035	hsa-miR-3161	PAR-CLIP	23446348
MIRT506034	hsa-miR-599	PAR-CLIP	23446348
MIRT506046	hsa-miR-362-5p	PAR-CLIP	23446348
MIRT506045	hsa-miR-500b-5p	PAR-CLIP	23446348
MIRT506044	hsa-miR-501-5p	PAR-CLIP	23446348
MIRT506043	hsa-miR-4308	PAR-CLIP	23446348
MIRT506042	hsa-miR-4292	PAR-CLIP	23446348
MIRT506041	hsa-miR-6791-5p	PAR-CLIP	23446348
MIRT506040	hsa-miR-378j	PAR-CLIP	23446348
MIRT506039	hsa-miR-6839-5p	PAR-CLIP	23446348
MIRT506038	hsa-miR-3167	PAR-CLIP	23446348
MIRT506037	hsa-miR-876-5p	PAR-CLIP	23446348
MIRT506036	hsa-miR-1290	PAR-CLIP	23446348
MIRT506035	hsa-miR-3161	PAR-CLIP	23446348
MIRT506034	hsa-miR-599	PAR-CLIP	23446348
MIRT1260468	hsa-miR-1255a	CLIP-seq
MIRT1260469	hsa-miR-1255b	CLIP-seq
MIRT1260470	hsa-miR-1286	CLIP-seq
MIRT1260471	hsa-miR-1297	CLIP-seq
MIRT1260472	hsa-miR-1303	CLIP-seq
MIRT1260473	hsa-miR-181a	CLIP-seq
MIRT1260474	hsa-miR-181b	CLIP-seq
MIRT1260475	hsa-miR-181c	CLIP-seq
MIRT1260476	hsa-miR-181d	CLIP-seq
MIRT1260477	hsa-miR-200b	CLIP-seq
MIRT1260478	hsa-miR-200c	CLIP-seq
MIRT1260479	hsa-miR-21	CLIP-seq
MIRT1260480	hsa-miR-23a	CLIP-seq
MIRT1260481	hsa-miR-23b	CLIP-seq
MIRT1260482	hsa-miR-23c	CLIP-seq
MIRT1260483	hsa-miR-26a	CLIP-seq
MIRT1260484	hsa-miR-26b	CLIP-seq
MIRT1260485	hsa-miR-297	CLIP-seq
MIRT1260486	hsa-miR-300	CLIP-seq
MIRT1260487	hsa-miR-31	CLIP-seq
MIRT1260488	hsa-miR-3126-5p	CLIP-seq
MIRT1260489	hsa-miR-3127-5p	CLIP-seq
MIRT1260490	hsa-miR-3149	CLIP-seq
MIRT1260491	hsa-miR-3617	CLIP-seq
MIRT1260492	hsa-miR-3647-3p	CLIP-seq
MIRT1260493	hsa-miR-374c	CLIP-seq
MIRT1260494	hsa-miR-381	CLIP-seq
MIRT1260495	hsa-miR-383	CLIP-seq
MIRT1260496	hsa-miR-3977	CLIP-seq
MIRT1260497	hsa-miR-4262	CLIP-seq
MIRT1260498	hsa-miR-4270	CLIP-seq
MIRT1260499	hsa-miR-4282	CLIP-seq
MIRT1260500	hsa-miR-429	CLIP-seq
MIRT1260501	hsa-miR-4291	CLIP-seq
MIRT1260502	hsa-miR-4307	CLIP-seq
MIRT1260503	hsa-miR-4317	CLIP-seq
MIRT1260504	hsa-miR-4328	CLIP-seq
MIRT1260505	hsa-miR-4419a	CLIP-seq
MIRT1260506	hsa-miR-4433	CLIP-seq
MIRT1260507	hsa-miR-4436a	CLIP-seq
MIRT1260508	hsa-miR-4441	CLIP-seq
MIRT1260509	hsa-miR-4465	CLIP-seq
MIRT1260510	hsa-miR-4510	CLIP-seq
MIRT1260511	hsa-miR-4653-3p	CLIP-seq
MIRT1260512	hsa-miR-4705	CLIP-seq
MIRT1260513	hsa-miR-4722-5p	CLIP-seq
MIRT1260514	hsa-miR-4772-5p	CLIP-seq
MIRT1260515	hsa-miR-4795-3p	CLIP-seq
MIRT1260516	hsa-miR-513a-3p	CLIP-seq
MIRT1260517	hsa-miR-520d-5p	CLIP-seq
MIRT1260518	hsa-miR-524-5p	CLIP-seq
MIRT1260519	hsa-miR-543	CLIP-seq
MIRT1260520	hsa-miR-545	CLIP-seq
MIRT1260521	hsa-miR-567	CLIP-seq
MIRT1260522	hsa-miR-590-5p	CLIP-seq
MIRT1260523	hsa-miR-602	CLIP-seq
MIRT1260524	hsa-miR-641	CLIP-seq
MIRT1260525	hsa-miR-655	CLIP-seq
MIRT1260526	hsa-miR-664	CLIP-seq
MIRT1260473	hsa-miR-181a	CLIP-seq
MIRT1260474	hsa-miR-181b	CLIP-seq
MIRT1260475	hsa-miR-181c	CLIP-seq
MIRT1260476	hsa-miR-181d	CLIP-seq
MIRT1260479	hsa-miR-21	CLIP-seq
MIRT1260480	hsa-miR-23a	CLIP-seq
MIRT1260481	hsa-miR-23b	CLIP-seq
MIRT1260482	hsa-miR-23c	CLIP-seq
MIRT1260527	hsa-miR-3137	CLIP-seq
MIRT1260528	hsa-miR-3194-5p	CLIP-seq
MIRT1260529	hsa-miR-3614-3p	CLIP-seq
MIRT1260491	hsa-miR-3617	CLIP-seq
MIRT1260492	hsa-miR-3647-3p	CLIP-seq
MIRT1260530	hsa-miR-3659	CLIP-seq
MIRT1260531	hsa-miR-3672	CLIP-seq
MIRT1260532	hsa-miR-369-3p	CLIP-seq
MIRT1260533	hsa-miR-374a	CLIP-seq
MIRT1260534	hsa-miR-374b	CLIP-seq
MIRT1260493	hsa-miR-374c	CLIP-seq
MIRT1260495	hsa-miR-383	CLIP-seq
MIRT1260535	hsa-miR-3976	CLIP-seq
MIRT1260496	hsa-miR-3977	CLIP-seq
MIRT1260536	hsa-miR-4252	CLIP-seq
MIRT1260497	hsa-miR-4262	CLIP-seq
MIRT1260499	hsa-miR-4282	CLIP-seq
MIRT1260504	hsa-miR-4328	CLIP-seq
MIRT1260507	hsa-miR-4436a	CLIP-seq
MIRT1260537	hsa-miR-4461	CLIP-seq
MIRT1260538	hsa-miR-4661-5p	CLIP-seq
MIRT1260539	hsa-miR-4676-5p	CLIP-seq
MIRT1260540	hsa-miR-4691-3p	CLIP-seq
MIRT1260512	hsa-miR-4705	CLIP-seq
MIRT1260514	hsa-miR-4772-5p	CLIP-seq
MIRT1260515	hsa-miR-4795-3p	CLIP-seq
MIRT1260541	hsa-miR-500b	CLIP-seq
MIRT1260516	hsa-miR-513a-3p	CLIP-seq
MIRT1260517	hsa-miR-520d-5p	CLIP-seq
MIRT1260518	hsa-miR-524-5p	CLIP-seq
MIRT1260542	hsa-miR-575	CLIP-seq
MIRT1260543	hsa-miR-587	CLIP-seq
MIRT1260522	hsa-miR-590-5p	CLIP-seq
MIRT1260524	hsa-miR-641	CLIP-seq
MIRT1260525	hsa-miR-655	CLIP-seq
MIRT1260544	hsa-miR-944	CLIP-seq
MIRT1260480	hsa-miR-23a	CLIP-seq
MIRT1260481	hsa-miR-23b	CLIP-seq
MIRT1260482	hsa-miR-23c	CLIP-seq
MIRT1260532	hsa-miR-369-3p	CLIP-seq
MIRT1260533	hsa-miR-374a	CLIP-seq
MIRT1260534	hsa-miR-374b	CLIP-seq
MIRT1260495	hsa-miR-383	CLIP-seq
MIRT1260514	hsa-miR-4772-5p	CLIP-seq
MIRT1260468	hsa-miR-1255a	CLIP-seq
MIRT1260469	hsa-miR-1255b	CLIP-seq
MIRT1260471	hsa-miR-1297	CLIP-seq
MIRT1260479	hsa-miR-21	CLIP-seq
MIRT1260480	hsa-miR-23a	CLIP-seq
MIRT1260481	hsa-miR-23b	CLIP-seq
MIRT1260482	hsa-miR-23c	CLIP-seq
MIRT1260483	hsa-miR-26a	CLIP-seq
MIRT1260484	hsa-miR-26b	CLIP-seq
MIRT1260487	hsa-miR-31	CLIP-seq
MIRT1260488	hsa-miR-3126-5p	CLIP-seq
MIRT1260489	hsa-miR-3127-5p	CLIP-seq
MIRT1260528	hsa-miR-3194-5p	CLIP-seq
MIRT1260532	hsa-miR-369-3p	CLIP-seq
MIRT1260533	hsa-miR-374a	CLIP-seq
MIRT1260534	hsa-miR-374b	CLIP-seq
MIRT1260495	hsa-miR-383	CLIP-seq
MIRT1260496	hsa-miR-3977	CLIP-seq
MIRT1260536	hsa-miR-4252	CLIP-seq
MIRT1260498	hsa-miR-4270	CLIP-seq
MIRT1260505	hsa-miR-4419a	CLIP-seq
MIRT1260508	hsa-miR-4441	CLIP-seq
MIRT1260509	hsa-miR-4465	CLIP-seq
MIRT1260510	hsa-miR-4510	CLIP-seq
MIRT1260538	hsa-miR-4661-5p	CLIP-seq
MIRT1260539	hsa-miR-4676-5p	CLIP-seq
MIRT1260540	hsa-miR-4691-3p	CLIP-seq
MIRT1260512	hsa-miR-4705	CLIP-seq
MIRT2303386	hsa-miR-4727-5p	CLIP-seq
MIRT2303387	hsa-miR-4769-3p	CLIP-seq
MIRT1260514	hsa-miR-4772-5p	CLIP-seq
MIRT1260515	hsa-miR-4795-3p	CLIP-seq
MIRT1260542	hsa-miR-575	CLIP-seq
MIRT1260522	hsa-miR-590-5p	CLIP-seq
MIRT2303388	hsa-miR-935	CLIP-seq
MIRT1260495	hsa-miR-383	CLIP-seq
MIRT1260514	hsa-miR-4772-5p	CLIP-seq
MIRT1260495	hsa-miR-383	CLIP-seq
MIRT1260514	hsa-miR-4772-5p	CLIP-seq
MIRT1260533	hsa-miR-374a	CLIP-seq
MIRT1260534	hsa-miR-374b	CLIP-seq
MIRT1260533	hsa-miR-374a	CLIP-seq
MIRT1260534	hsa-miR-374b	CLIP-seq
MIRT1260470	hsa-miR-1286	CLIP-seq
MIRT1260471	hsa-miR-1297	CLIP-seq
MIRT1260472	hsa-miR-1303	CLIP-seq
MIRT1260473	hsa-miR-181a	CLIP-seq
MIRT1260474	hsa-miR-181b	CLIP-seq
MIRT1260475	hsa-miR-181c	CLIP-seq
MIRT1260476	hsa-miR-181d	CLIP-seq
MIRT1260477	hsa-miR-200b	CLIP-seq
MIRT1260478	hsa-miR-200c	CLIP-seq
MIRT1260479	hsa-miR-21	CLIP-seq
MIRT1260480	hsa-miR-23a	CLIP-seq
MIRT1260481	hsa-miR-23b	CLIP-seq
MIRT1260482	hsa-miR-23c	CLIP-seq
MIRT1260483	hsa-miR-26a	CLIP-seq
MIRT1260484	hsa-miR-26b	CLIP-seq
MIRT1260486	hsa-miR-300	CLIP-seq
MIRT1260487	hsa-miR-31	CLIP-seq
MIRT1260527	hsa-miR-3137	CLIP-seq
MIRT1260528	hsa-miR-3194-5p	CLIP-seq
MIRT1260529	hsa-miR-3614-3p	CLIP-seq
MIRT1260491	hsa-miR-3617	CLIP-seq
MIRT1260492	hsa-miR-3647-3p	CLIP-seq
MIRT2599981	hsa-miR-3686	CLIP-seq
MIRT1260532	hsa-miR-369-3p	CLIP-seq
MIRT1260493	hsa-miR-374c	CLIP-seq
MIRT1260494	hsa-miR-381	CLIP-seq
MIRT1260495	hsa-miR-383	CLIP-seq
MIRT1260535	hsa-miR-3976	CLIP-seq
MIRT1260496	hsa-miR-3977	CLIP-seq
MIRT1260536	hsa-miR-4252	CLIP-seq
MIRT1260497	hsa-miR-4262	CLIP-seq
MIRT1260499	hsa-miR-4282	CLIP-seq
MIRT1260500	hsa-miR-429	CLIP-seq
MIRT1260503	hsa-miR-4317	CLIP-seq
MIRT1260504	hsa-miR-4328	CLIP-seq
MIRT1260506	hsa-miR-4433	CLIP-seq
MIRT1260507	hsa-miR-4436a	CLIP-seq
MIRT1260509	hsa-miR-4465	CLIP-seq
MIRT1260511	hsa-miR-4653-3p	CLIP-seq
MIRT1260538	hsa-miR-4661-5p	CLIP-seq
MIRT2599982	hsa-miR-4662a-5p	CLIP-seq
MIRT1260539	hsa-miR-4676-5p	CLIP-seq
MIRT1260540	hsa-miR-4691-3p	CLIP-seq
MIRT1260512	hsa-miR-4705	CLIP-seq
MIRT2599983	hsa-miR-4716-5p	CLIP-seq
MIRT1260513	hsa-miR-4722-5p	CLIP-seq
MIRT1260514	hsa-miR-4772-5p	CLIP-seq
MIRT1260515	hsa-miR-4795-3p	CLIP-seq
MIRT2599984	hsa-miR-502-5p	CLIP-seq
MIRT1260516	hsa-miR-513a-3p	CLIP-seq
MIRT1260517	hsa-miR-520d-5p	CLIP-seq
MIRT1260518	hsa-miR-524-5p	CLIP-seq
MIRT1260519	hsa-miR-543	CLIP-seq
MIRT1260542	hsa-miR-575	CLIP-seq
MIRT1260522	hsa-miR-590-5p	CLIP-seq
MIRT1260523	hsa-miR-602	CLIP-seq
MIRT1260524	hsa-miR-641	CLIP-seq
MIRT1260525	hsa-miR-655	CLIP-seq
MIRT1260526	hsa-miR-664	CLIP-seq
MIRT1260523	hsa-miR-602	CLIP-seq
MIRT1260470	hsa-miR-1286	CLIP-seq
MIRT1260471	hsa-miR-1297	CLIP-seq
MIRT1260473	hsa-miR-181a	CLIP-seq
MIRT1260474	hsa-miR-181b	CLIP-seq
MIRT1260475	hsa-miR-181c	CLIP-seq
MIRT1260476	hsa-miR-181d	CLIP-seq
MIRT1260479	hsa-miR-21	CLIP-seq
MIRT1260480	hsa-miR-23a	CLIP-seq
MIRT1260481	hsa-miR-23b	CLIP-seq
MIRT1260482	hsa-miR-23c	CLIP-seq
MIRT1260483	hsa-miR-26a	CLIP-seq
MIRT1260484	hsa-miR-26b	CLIP-seq
MIRT1260487	hsa-miR-31	CLIP-seq
MIRT1260527	hsa-miR-3137	CLIP-seq
MIRT1260528	hsa-miR-3194-5p	CLIP-seq
MIRT1260529	hsa-miR-3614-3p	CLIP-seq
MIRT1260491	hsa-miR-3617	CLIP-seq
MIRT1260492	hsa-miR-3647-3p	CLIP-seq
MIRT2599981	hsa-miR-3686	CLIP-seq
MIRT1260532	hsa-miR-369-3p	CLIP-seq
MIRT1260493	hsa-miR-374c	CLIP-seq
MIRT1260495	hsa-miR-383	CLIP-seq
MIRT1260535	hsa-miR-3976	CLIP-seq
MIRT1260496	hsa-miR-3977	CLIP-seq
MIRT1260536	hsa-miR-4252	CLIP-seq
MIRT1260497	hsa-miR-4262	CLIP-seq
MIRT1260499	hsa-miR-4282	CLIP-seq
MIRT1260503	hsa-miR-4317	CLIP-seq
MIRT1260504	hsa-miR-4328	CLIP-seq
MIRT1260506	hsa-miR-4433	CLIP-seq
MIRT1260507	hsa-miR-4436a	CLIP-seq
MIRT1260509	hsa-miR-4465	CLIP-seq
MIRT1260511	hsa-miR-4653-3p	CLIP-seq
MIRT1260538	hsa-miR-4661-5p	CLIP-seq
MIRT2599982	hsa-miR-4662a-5p	CLIP-seq
MIRT1260539	hsa-miR-4676-5p	CLIP-seq
MIRT1260540	hsa-miR-4691-3p	CLIP-seq
MIRT1260512	hsa-miR-4705	CLIP-seq
MIRT2599983	hsa-miR-4716-5p	CLIP-seq
MIRT1260513	hsa-miR-4722-5p	CLIP-seq
MIRT1260514	hsa-miR-4772-5p	CLIP-seq
MIRT1260515	hsa-miR-4795-3p	CLIP-seq
MIRT2599984	hsa-miR-502-5p	CLIP-seq
MIRT1260516	hsa-miR-513a-3p	CLIP-seq
MIRT1260517	hsa-miR-520d-5p	CLIP-seq
MIRT1260518	hsa-miR-524-5p	CLIP-seq
MIRT1260519	hsa-miR-543	CLIP-seq
MIRT1260542	hsa-miR-575	CLIP-seq
MIRT1260522	hsa-miR-590-5p	CLIP-seq
MIRT1260523	hsa-miR-602	CLIP-seq
MIRT1260524	hsa-miR-641	CLIP-seq
MIRT1260525	hsa-miR-655	CLIP-seq
MIRT1260526	hsa-miR-664	CLIP-seq
MIRT1260472	hsa-miR-1303	CLIP-seq
MIRT1260523	hsa-miR-602	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYC	Activation	12011429
NRF1	Activation	21051700

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001893	Process	Maternal placenta development	IEA
GO:0004601	Function	Peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	12492477, 15750338, 17060495, 18205602, 20873783, 21850687, 24459295, 25416956, 29892012, 31046837, 31515488, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	18205602
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	17893648, 18262354, 21850687
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	15750338
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	21850687
GO:0005886	Component	Plasma membrane	IDA
GO:0006979	Process	Response to oxidative stress	IBA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IMP	18195003
GO:0007005	Process	Mitochondrion organization	IMP	12011429
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	12011429
GO:0008379	Function	Thioredoxin peroxidase activity	IBA
GO:0008379	Function	Thioredoxin peroxidase activity	IDA	21850687
GO:0016209	Function	Antioxidant activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019901	Function	Protein kinase binding	IPI	21850687
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030099	Process	Myeloid cell differentiation	ISS
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032991	Component	Protein-containing complex	IDA	20873783
GO:0033673	Process	Negative regulation of kinase activity	IDA	18205602
GO:0034599	Process	Cellular response to oxidative stress	IDA	21850687
GO:0034614	Process	Cellular response to reactive oxygen species	IMP	18262354
GO:0042542	Process	Response to hydrogen peroxide	IDA	17893648
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA
GO:0042744	Process	Hydrogen peroxide catabolic process	IDA	7733872
GO:0042744	Process	Hydrogen peroxide catabolic process	IMP	18195003
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	21988832, 25914057
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	18262354
GO:0043066	Process	Negative regulation of apoptotic process	IDA	21850687
GO:0043066	Process	Negative regulation of apoptotic process	IMP	18262354
GO:0045454	Process	Cell redox homeostasis	IBA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	12492477
GO:0051881	Process	Regulation of mitochondrial membrane potential	IMP	12011429
GO:0051920	Function	Peroxiredoxin activity	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:0102039	Function	NADH-dependent peroxiredoxin activity	NAS	7733872
GO:0140824	Function	Thioredoxin-dependent peroxiredoxin activity	IEA

Other IDs

• MIM: 604769
• HGNC: 9354
• e!Ensembl: ENSG00000165672

Protein

• UniProt ID: P30048
• Protein name: Thioredoxin-dependent peroxide reductase, mitochondrial (EC 1.11.1.24) (Antioxidant protein 1) (AOP-1) (HBC189) (Peroxiredoxin III) (Prx-III) (Peroxiredoxin-3) (Protein MER5 homolog) (Thioredoxin-dependent peroxiredoxin 3)
• Protein function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides (PubMed:17707404, PubMe
• PDB: 5JCG, 5UCX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00578	AhpC-TSA	65 → 198	AhpC/TSA family	Domain
  PF10417	1-cysPrx_C	218 → 253	C-terminal domain of 1-Cys peroxiredoxin	Domain

• Sequence:

  MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSC
  HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
  EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSG
  LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTI
  KPSPAASKEYFQKVNQ

• Sequence length: 256

Pathways

Reactome:

Detoxification of Reactive Oxygen Species

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal recessive cerebellar ataxia	Likely pathogenic; Pathogenic	rs371560438	RCV001785420	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Corneal dystrophy, punctiform and polychromatic pre-descemet	Likely pathogenic; Pathogenic	rs371560438, rs2133650052	RCV003989712 RCV002248455	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spinocerebellar ataxia, autosomal recessive 32	Likely pathogenic; Pathogenic	rs371560438, rs548327727, rs2133659317, rs140609531, rs1368897658, rs925412397, rs2493973819	RCV003225750 RCV002248450 RCV002248451 RCV002248452 RCV002248454 RCV003152444 RCV003159262	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	8496166		★☆☆☆☆ Found in Text Mining only
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	28240739		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	19408305		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26810067		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	23227829		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32711556, 37762527	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior Horn Cell Disease	Anterior Horn Cell Disease	CTD_human_DG	16702190		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	36233161	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	22051046	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29113303		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20043069, 20541551		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20541551, 29545070	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24815434, 31215439, 33771165	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	22496757		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16635084, 22016591, 31771972		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23564483	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23510786, 25093297	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	25397948	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27010651		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	37553803	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	36233161, 37553803	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	22496757		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22496757		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	23227829		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28240739		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26350748		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	26091938		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26350748	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25093297		★☆☆☆☆ Found in Text Mining only
Corneal Dystrophies Hereditary	Corneal dystrophy	Pubtator	31782998, 34369396	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	16081686		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	11771746, 12650976		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	12650976		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	30763715	Inhibit	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	30312344	Associate	★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	Pubtator	37553803	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29190956, 29541251		★☆☆☆☆ Found in Text Mining only
Familial Motor Neuron Disease	Motor Neuron Disease	CTD_human_DG	16702190		★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	25671835	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	18772530		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	24773279		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	24773279	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30528738		★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	37553803	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	37047426	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25093297	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	27958341	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28240739		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	27966448	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	27966448		★☆☆☆☆ Found in Text Mining only
Lateral Sclerosis	Lateral Sclerosis	CTD_human_DG	16702190		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24828865	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	19408305, 32975211	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24828865		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12530083		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15703822, 22344546, 24105047, 26983019, 28994702, 31500275		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	36233161	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	25462069		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20043069, 20541551		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29190956, 29541251		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24105047, 26983019		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16635084, 22016591, 31500275, 31771972		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21031435, 22424448, 22710126		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21031435, 22496757, 25462069, 27966448, 29541251, 31500275		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22496757		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26350748		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	23227829		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23227829	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19383853	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	22761781, 23018647, 25462069	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27958341	Inhibit	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	32711556	Associate	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	16702190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Motor Neuron Disease	Motor Neuron Disease	CTD_human_DG	16702190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Motor Neuron Disease, Lower	Motor Neuron Disease	CTD_human_DG	16702190		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease, Secondary	Motor Neuron Disease	CTD_human_DG	16702190		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease, Upper	Motor Neuron Disease	CTD_human_DG	16702190		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25492529		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	BEFREE	18772530		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23217164	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28184180		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21031435, 22424448, 25462069, 26091938, 27966448, 31636803		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18262354		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21127481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	21127481	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oculocutaneous albinism type 1A	Oculocutaneous albinism	BEFREE	28240739		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37312219	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23564483, 30104402	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18262354		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	12650976		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	LHGDN	12650976		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30871530		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21031435, 22424448, 22710126		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	23880827	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21031435, 22710126	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23880827	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	11828047	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29540208		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30312344	Associate	★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	37553803	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22016591		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27966448	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32382548, 36647961	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29876982		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	22496757	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22496757	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	31771972		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction	Ventricular dysfunction	Pubtator	25397948	Stimulate	★☆☆☆☆ Found in Text Mining only