Gene Gene information from NCBI Gene database.
Entrez ID 10923
Gene name SUB1 regulator of transcription
Gene symbol SUB1
Synonyms (NCBI Gene)
P15PC4p14
Chromosome 5
Chromosome location 5p13.3
miRNA miRNA information provided by mirtarbase database.
650
miRTarBase ID miRNA Experiments Reference
MIRT019809 hsa-miR-375 Microarray 20215506
MIRT027373 hsa-miR-101-3p Sequencing 20371350
MIRT051658 hsa-let-7e-5p CLASH 23622248
MIRT614533 hsa-miR-548ae-3p HITS-CLIP 23824327
MIRT614532 hsa-miR-548ah-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0001111 Process RNA polymerase II promoter clearance IDA 25308091
GO:0003677 Function DNA binding IEA
GO:0003697 Function Single-stranded DNA binding IDA 8062391
GO:0003713 Function Transcription coactivator activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600503 19985 ENSG00000113387
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P53999
Protein name Activated RNA polymerase II transcriptional coactivator p15 (Positive cofactor 4) (PC4) (SUB1 homolog) (p14)
Protein function General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds s
PDB 1PCF , 2C62 , 2PHE , 4USG , 6YCS , 7E4W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02229 PC4 64 116 Transcriptional Coactivator p15 (PC4) Domain
Sequence
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRD
DNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDI
DDAVRKL
Sequence length 127
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
11
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Abetalipoproteinemia Abetalipoproteinemia BEFREE 10706859
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 10073286, 10498617, 10634644, 10706859, 11413509, 15755508, 27401303, 8616035, 9447829
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 10706859, 11380466, 11413509, 14666292, 15978938, 26333125, 27401303, 8616035, 8683987, 9447829, 9737691
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 10634644, 11532526
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 11283136, 12750706, 18587015, 28052659
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 20978327, 21538028
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 15189501, 19947923, 26986751
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma, Endometrioid Endometrial Cancer BEFREE 15213599
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 21464964
★☆☆☆☆
Found in Text Mining only
Adenoma, Microcystic Adenoma BEFREE 14614047
★☆☆☆☆
Found in Text Mining only