GADD45G (growth arrest and DNA damage inducible gamma)

Gene

• Entrez ID: 10912
• Gene name: Growth arrest and DNA damage inducible gamma
• Gene symbol: GADD45G
• Synonyms (NCBI Gene): CR6, DDIT2, GADD45gamma, GRP17
• Chromosome: 9
• Chromosome location: 9q22.2
• Summary: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activatio

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025170	hsa-miR-181a-5p	Microarray	17612493
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT1010248	hsa-miR-4532	CLIP-seq
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT1010248	hsa-miR-4532	CLIP-seq
MIRT2232908	hsa-miR-103a	CLIP-seq
MIRT2232909	hsa-miR-107	CLIP-seq
MIRT2232910	hsa-miR-1291	CLIP-seq
MIRT2232911	hsa-miR-1343	CLIP-seq
MIRT2232912	hsa-miR-15a	CLIP-seq
MIRT2232913	hsa-miR-15b	CLIP-seq
MIRT2232914	hsa-miR-16	CLIP-seq
MIRT2232915	hsa-miR-195	CLIP-seq
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT2232916	hsa-miR-1976	CLIP-seq
MIRT2232917	hsa-miR-205	CLIP-seq
MIRT2232918	hsa-miR-3173-5p	CLIP-seq
MIRT2232919	hsa-miR-328	CLIP-seq
MIRT2232920	hsa-miR-330-3p	CLIP-seq
MIRT2232921	hsa-miR-3691-3p	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT2232922	hsa-miR-421	CLIP-seq
MIRT2232923	hsa-miR-424	CLIP-seq
MIRT2232924	hsa-miR-4282	CLIP-seq
MIRT2232925	hsa-miR-4632	CLIP-seq
MIRT2232926	hsa-miR-4685-5p	CLIP-seq
MIRT2232927	hsa-miR-4709-5p	CLIP-seq
MIRT2232928	hsa-miR-4772-3p	CLIP-seq
MIRT2232929	hsa-miR-497	CLIP-seq
MIRT2232930	hsa-miR-891b	CLIP-seq
MIRT1010246	hsa-miR-197	CLIP-seq
MIRT1010247	hsa-miR-383	CLIP-seq
MIRT1010248	hsa-miR-4532	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPB	Unknown	11012671
CEBPD	Unknown	11012671
NFKB1	Unknown	23681230
RELA	Unknown	23681230

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12052864, 12716909, 15383276, 16189514, 21900206, 21988832, 25416956, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9827804
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9827804
GO:0006915	Process	Apoptotic process	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9827804
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	9827804
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	25071184
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	9827804

Other IDs

• MIM: 604949
• HGNC: 4097
• e!Ensembl: ENSG00000130222

Protein

• UniProt ID: O95257
• Protein name: Growth arrest and DNA damage-inducible protein GADD45 gamma (Cytokine-responsive protein CR6) (DNA damage-inducible transcript 2 protein) (DDIT-2)
• Protein function: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
• PDB: 2WAL, 3FFM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01248	Ribosomal_L7Ae	24 → 113	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family	Domain

• Sequence:

  MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
  VLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
  LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

• Sequence length: 159

Pathways

KEGG:

MAPK signaling pathway
NF-kappa B signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Apoptosis
Cellular senescence
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Thyroid cancer
Basal cell carcinoma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GADD45G-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	14647444, 25126861		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	38537674	Associate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	31826946		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	29023909, 31584201		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	12915687		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29126025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	29023909, 31584201		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22895549		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21568272		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21568272, 23313378, 23824011	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nose	Nose Cancer	BEFREE	30778374		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20652500	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25912578, 36776954, 39273406	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22895549		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15518579, 16251206, 21742780, 23518002, 25174529, 25448439, 26843424, 27323401, 28881718, 29782351, 30690063, 30896278, 31228494, 31504995, 31623305		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	32138671	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30710761		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	23512105	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31826946		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24763055	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	16904935		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21944129		★☆☆☆☆ Found in Text Mining only
Corneal Dystrophies Hereditary	Corneal dystrophy	Pubtator	35028007	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29572843, 31652346		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	29572843, 31584201		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	29572843		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23793925		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23793925		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25912578	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	37657050	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31756458		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	28985946		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	23616123		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37086071	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32138671	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	24577085	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31826946		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36982840	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	28472532		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	29064106		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	18354378, 29644063		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30236763		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14672412, 25912578, 26172295, 26378039		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14672412		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	14672412, 26378039		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	23518002, 28881718, 29782351		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25174529, 26843424		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21568272		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23793925		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31376806		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15518579, 16251206, 21742780, 23518002, 25174529, 25448439, 26843424, 27323401, 28881718, 29782351, 30690063, 30896278, 31228494, 31504995, 31623305		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20111973		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20739400, 22895549, 30315950		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20111973, 21766833, 30778374, 30896278		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30778374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22895549		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17178890, 19616015, 21766833, 23681230, 25912578, 27404458, 28218450, 28389273, 29064106, 29076985, 29126025, 29391238, 29880483, 30148840, 30634092, 30778374, 31185334, 31504995, 31623305, 31818582		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31589552		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	33080073	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25245461		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25245461	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12915687, 14647444, 16166418, 20111973, 21390129, 21568272, 21742780, 23616123, 23793925, 25448439, 26378039, 26843424, 28881718, 29561703		★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	11889197		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27861856		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25912578	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	11889197		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20739400, 22895549, 30315950		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20739400	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	30315950		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	23516551		★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30933861		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23793925, 25912578, 31562612		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30896278		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	24283650		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30778374		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30778374		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	35137664	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32138671	Associate	★☆☆☆☆ Found in Text Mining only