Gene Gene information from NCBI Gene database.
Entrez ID 10910
Gene name SGT1 assembly cochaperone of MIS12 kinetochore complex
Gene symbol SUGT1
Synonyms (NCBI Gene)
SGT1
Chromosome 13
Chromosome location 13q14.3
Summary This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudoge
miRNA miRNA information provided by mirtarbase database.
604
miRTarBase ID miRNA Experiments Reference
MIRT025348 hsa-miR-34a-5p Proteomics 21566225
MIRT670697 hsa-miR-634 HITS-CLIP 23313552
MIRT670696 hsa-miR-4690-5p HITS-CLIP 23313552
MIRT670695 hsa-miR-214-3p HITS-CLIP 23313552
MIRT670694 hsa-miR-3619-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex TAS 10445024
GO:0000776 Component Kinetochore IEA
GO:0000776 Component Kinetochore TAS 10445024
GO:0005515 Function Protein binding IPI 17420470, 18818696, 21566117, 23935490, 24255178
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604098 16987 ENSG00000165416
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y2Z0
Protein name Protein SGT1 homolog (Protein 40-6-3) (Sgt1) (Suppressor of G2 allele of SKP1 homolog)
Protein function May play a role in ubiquitination and subsequent proteasomal degradation of target proteins.
PDB 1RL1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04969 CS 172 248 CS domain Domain
PF05002 SGS 285 365 SGS domain Domain
Sequence
MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGN
YCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQA
GLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTE
SQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLST
KIEIKLKK
PEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKN
EKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDM
EWKKY
Sequence length 365
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  NOD-like receptor signaling pathway   The NLRP3 inflammasome
Purinergic signaling in leishmaniasis infection
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Congestive heart failure Congestive Heart Failure BEFREE 15733902
★☆☆☆☆
Found in Text Mining only
Heart failure Heart Failure BEFREE 15733902
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Inflammatory bowel disease Pubtator 28422189 Associate
★☆☆☆☆
Found in Text Mining only
Lewy Body Disease Lewy Body Disease BEFREE 30741686
★☆☆☆☆
Found in Text Mining only
Lewy Body Disease Lewy body disease Pubtator 30741686 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 23440515
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 23440515
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease BEFREE 30741686
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease Pubtator 30741686 Stimulate
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease Pubtator 34827672 Associate
★☆☆☆☆
Found in Text Mining only