Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10903
Gene name	Myotubularin related protein 11
Gene symbol	MTMR11
Synonyms (NCBI Gene)	CRA
Chromosome	1
Chromosome location	1q21.2

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments
MIRT1163698	hsa-miR-320a	CLIP-seq
MIRT1163699	hsa-miR-320b	CLIP-seq
MIRT1163700	hsa-miR-320c	CLIP-seq
MIRT1163701	hsa-miR-320d	CLIP-seq
MIRT1163702	hsa-miR-3616-5p	CLIP-seq
MIRT1163703	hsa-miR-3647-5p	CLIP-seq
MIRT1163704	hsa-miR-4429	CLIP-seq
MIRT1163705	hsa-miR-4446-3p	CLIP-seq
MIRT1163706	hsa-miR-4656	CLIP-seq
MIRT1163707	hsa-miR-4795-5p	CLIP-seq
MIRT1163708	hsa-miR-573	CLIP-seq
MIRT1163709	hsa-miR-595	CLIP-seq
MIRT2047062	hsa-miR-105	CLIP-seq
MIRT2047063	hsa-miR-205	CLIP-seq
MIRT2047064	hsa-miR-3671	CLIP-seq
MIRT2047065	hsa-miR-607	CLIP-seq
MIRT2575021	hsa-miR-1248	CLIP-seq
MIRT2575022	hsa-miR-2467-5p	CLIP-seq
MIRT2575023	hsa-miR-3188	CLIP-seq
MIRT1163698	hsa-miR-320a	CLIP-seq
MIRT1163699	hsa-miR-320b	CLIP-seq
MIRT1163700	hsa-miR-320c	CLIP-seq
MIRT1163701	hsa-miR-320d	CLIP-seq
MIRT2575024	hsa-miR-3606	CLIP-seq
MIRT1163702	hsa-miR-3616-5p	CLIP-seq
MIRT1163703	hsa-miR-3647-5p	CLIP-seq
MIRT2575025	hsa-miR-3674	CLIP-seq
MIRT2575026	hsa-miR-3975	CLIP-seq
MIRT1163704	hsa-miR-4429	CLIP-seq
MIRT1163705	hsa-miR-4446-3p	CLIP-seq
MIRT2575027	hsa-miR-4649-3p	CLIP-seq
MIRT1163706	hsa-miR-4656	CLIP-seq
MIRT1163707	hsa-miR-4795-5p	CLIP-seq
MIRT2575028	hsa-miR-485-5p	CLIP-seq
MIRT2575029	hsa-miR-548p	CLIP-seq
MIRT1163708	hsa-miR-573	CLIP-seq
MIRT1163709	hsa-miR-595	CLIP-seq
MIRT2575030	hsa-miR-921	CLIP-seq
MIRT2575021	hsa-miR-1248	CLIP-seq
MIRT2685488	hsa-miR-2276	CLIP-seq
MIRT2575022	hsa-miR-2467-5p	CLIP-seq
MIRT2575023	hsa-miR-3188	CLIP-seq
MIRT1163698	hsa-miR-320a	CLIP-seq
MIRT1163699	hsa-miR-320b	CLIP-seq
MIRT1163700	hsa-miR-320c	CLIP-seq
MIRT1163701	hsa-miR-320d	CLIP-seq
MIRT2575024	hsa-miR-3606	CLIP-seq
MIRT1163702	hsa-miR-3616-5p	CLIP-seq
MIRT1163703	hsa-miR-3647-5p	CLIP-seq
MIRT2575025	hsa-miR-3674	CLIP-seq
MIRT2575026	hsa-miR-3975	CLIP-seq
MIRT1163704	hsa-miR-4429	CLIP-seq
MIRT1163705	hsa-miR-4446-3p	CLIP-seq
MIRT2685489	hsa-miR-451b	CLIP-seq
MIRT2575027	hsa-miR-4649-3p	CLIP-seq
MIRT1163706	hsa-miR-4656	CLIP-seq
MIRT2685490	hsa-miR-4696	CLIP-seq
MIRT1163707	hsa-miR-4795-5p	CLIP-seq
MIRT2575028	hsa-miR-485-5p	CLIP-seq
MIRT2575029	hsa-miR-548p	CLIP-seq
MIRT1163708	hsa-miR-573	CLIP-seq
MIRT1163709	hsa-miR-595	CLIP-seq
MIRT2575030	hsa-miR-921	CLIP-seq

Show/Hide all (4)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16787938
GO:0016020	Component	Membrane	IBA
GO:0070062	Component	Extracellular exosome	HDA	18570454

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

A4FU01

Protein name

Myotubularin-related protein 11 (Cisplatin resistance-associated protein) (hCRA) (Inactive phosphatidylinositol 3-phosphatase 11)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06602	Myotub-related	169 → 318	Myotubularin-like phosphatase domain	Domain
PF06602	Myotub-related	302 → 483	Myotubularin-like phosphatase domain	Domain
PF12578	3-PAP	548 → 678	Myotubularin-associated protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in bone marrow, spleen and thymus. {ECO:0000269|PubMed:17498563}.

Sequence

MWWGGRGQSFNIAPQKEEPEMGSVQENRMPEPRSRQPSSCLASRCLPGEQILAWAPGVRK
GLEPELSGTLICTNFRVTFQPCGWQWNQDTPLNSEYDFALVNIGRLEAVSGLSRVQLLRP
GSLHKFIPEEILIHGRDFRLLRVGFEAGGLEPQAFQVTMAIVQARAQSNQAQQYSGITLS
KAGQGSGSRKPPIPLMETAEDWETERKKQAARGWRVSTVNERFDVATSLPRYFWVPNRIL
DSEVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDV
VLVDTMDELPSLADVQLAHLRLRALCLPDSSVAEDKWLSALEGTRWLDYVRACLRKASDI
SVLVTSRVRSVILQERGDRDLNGLLSSLVQLLSAPEARTLFGFQSLVQREWVAAGHPFLT
RLGGTGASEEAPVFLLFLDCVWQLLQQFPADFEFSEFFLLALHDSVRVPDTLTFLRNTPW
ERGKQSGQLNSYTQVYTPGYSQPPAGNSFNLQLSVWDWDLRYSNAQILQFQNPGYDPEHC
PDSWLPRPQPSFMVPGPPSSVWLFSRGALTPLNQLCPWRDSPSLLAVSSRWLPRPAISSE
SLADQEWGLPSHWGACPLPPGLLLPGYLGPQIRLWRRCYLRGRPEVQMGLSAPTISGLQD
ELSHLQELLRKWTPRISPEDHSKKRDPHTILNPTEIAGILKGRAEGDLG

Sequence length

709

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma of large intestine	Colorectal adenoma	BEFREE	30791768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	25993293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	20413845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cheilitis	Cheilitis	BEFREE	28786105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	BEFREE	27144525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31384612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	3514807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	11879359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	25504633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29325917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	30347030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	30347030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	25504633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28506699, 30791768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16891455, 20413845, 28786105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29803928, 30791768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29079785, 30274272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24467821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	29275174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	29275174		★★★★★ ★☆☆☆☆ Found in Text Mining only

MTMR11 (myotubularin related protein 11)