LYVE1 (lymphatic vessel endothelial hyaluronan receptor 1)

Gene

• Entrez ID: 10894
• Gene name: Lymphatic vessel endothelial hyaluronan receptor 1
• Gene symbol: LYVE1
• Synonyms (NCBI Gene): CRSBP-1, HAR, LYVE-1, XLKD1
• Chromosome: 11
• Chromosome location: 11p15.4
• Summary: This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis. [provi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023074	hsa-miR-124-3p	Microarray	18668037
MIRT532074	hsa-miR-551b-5p	HITS-CLIP	23824327
MIRT650047	hsa-miR-34a-3p	HITS-CLIP	23824327
MIRT634561	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT634560	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT634559	hsa-miR-4690-3p	HITS-CLIP	23824327
MIRT634558	hsa-miR-5685	HITS-CLIP	23824327
MIRT634557	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT634556	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT634555	hsa-miR-3194-5p	HITS-CLIP	23824327
MIRT634554	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT634552	hsa-miR-587	HITS-CLIP	23824327
MIRT532074	hsa-miR-551b-5p	HITS-CLIP	23824327
MIRT650047	hsa-miR-34a-3p	HITS-CLIP	23824327
MIRT634561	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT634560	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT634559	hsa-miR-4690-3p	HITS-CLIP	23824327
MIRT634558	hsa-miR-5685	HITS-CLIP	23824327
MIRT634557	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT634556	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT634555	hsa-miR-3194-5p	HITS-CLIP	23824327
MIRT634554	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT634553	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT634552	hsa-miR-587	HITS-CLIP	23824327
MIRT634561	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT634560	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT634559	hsa-miR-4690-3p	HITS-CLIP	23824327
MIRT634558	hsa-miR-5685	HITS-CLIP	23824327
MIRT634557	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT634556	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT634555	hsa-miR-3194-5p	HITS-CLIP	23824327
MIRT634554	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT634553	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT634552	hsa-miR-587	HITS-CLIP	23824327
MIRT532074	hsa-miR-551b-5p	PAR-CLIP	22012620
MIRT532073	hsa-miR-6861-5p	PAR-CLIP	22012620
MIRT532072	hsa-miR-503-3p	PAR-CLIP	22012620
MIRT532071	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT532074	hsa-miR-551b-5p	HITS-CLIP	23824327
MIRT650047	hsa-miR-34a-3p	HITS-CLIP	23824327
MIRT634561	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT634560	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT634559	hsa-miR-4690-3p	HITS-CLIP	23824327
MIRT634558	hsa-miR-5685	HITS-CLIP	23824327
MIRT634557	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT634556	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT634555	hsa-miR-3194-5p	HITS-CLIP	23824327
MIRT634554	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT634552	hsa-miR-587	HITS-CLIP	23824327
MIRT532074	hsa-miR-551b-5p	HITS-CLIP	23824327
MIRT650047	hsa-miR-34a-3p	HITS-CLIP	23824327
MIRT634561	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT634560	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT634559	hsa-miR-4690-3p	HITS-CLIP	23824327
MIRT634558	hsa-miR-5685	HITS-CLIP	23824327
MIRT634557	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT634556	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT634555	hsa-miR-3194-5p	HITS-CLIP	23824327
MIRT634554	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT634553	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT634552	hsa-miR-587	HITS-CLIP	23824327
MIRT634561	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT634560	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT634559	hsa-miR-4690-3p	HITS-CLIP	23824327
MIRT634558	hsa-miR-5685	HITS-CLIP	23824327
MIRT634557	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT634556	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT634555	hsa-miR-3194-5p	HITS-CLIP	23824327
MIRT634554	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT634553	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT634552	hsa-miR-587	HITS-CLIP	23824327
MIRT532074	hsa-miR-551b-5p	PAR-CLIP	22012620
MIRT532073	hsa-miR-6861-5p	PAR-CLIP	22012620
MIRT532072	hsa-miR-503-3p	PAR-CLIP	22012620
MIRT532071	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT1124297	hsa-miR-1245b-5p	CLIP-seq
MIRT1124298	hsa-miR-1324	CLIP-seq
MIRT1124299	hsa-miR-199a-3p	CLIP-seq
MIRT1124300	hsa-miR-199b-3p	CLIP-seq
MIRT1124301	hsa-miR-2053	CLIP-seq
MIRT1124302	hsa-miR-3123	CLIP-seq
MIRT1124303	hsa-miR-3129-5p	CLIP-seq
MIRT1124304	hsa-miR-3142	CLIP-seq
MIRT1124305	hsa-miR-3160-3p	CLIP-seq
MIRT1124306	hsa-miR-3925-5p	CLIP-seq
MIRT1124307	hsa-miR-4291	CLIP-seq
MIRT1124308	hsa-miR-4303	CLIP-seq
MIRT1124309	hsa-miR-4452	CLIP-seq
MIRT1124310	hsa-miR-4459	CLIP-seq
MIRT1124311	hsa-miR-4487	CLIP-seq
MIRT1124312	hsa-miR-4695-5p	CLIP-seq
MIRT1124313	hsa-miR-545	CLIP-seq
MIRT1124314	hsa-miR-558	CLIP-seq
MIRT1124315	hsa-miR-567	CLIP-seq
MIRT1124316	hsa-miR-569	CLIP-seq
MIRT1124317	hsa-miR-653	CLIP-seq
MIRT1124318	hsa-miR-665	CLIP-seq
MIRT1124319	hsa-miR-936	CLIP-seq
MIRT2035140	hsa-miR-544	CLIP-seq
MIRT2265546	hsa-miR-1207-3p	CLIP-seq
MIRT2265547	hsa-miR-1207-5p	CLIP-seq
MIRT2265548	hsa-miR-2054	CLIP-seq
MIRT2265549	hsa-miR-3173-3p	CLIP-seq
MIRT2265550	hsa-miR-4428	CLIP-seq
MIRT2265551	hsa-miR-4719	CLIP-seq
MIRT2265552	hsa-miR-4731-5p	CLIP-seq
MIRT2265553	hsa-miR-4763-3p	CLIP-seq
MIRT2265554	hsa-miR-486-3p	CLIP-seq
MIRT2265555	hsa-miR-555	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002693	Process	Positive regulation of cellular extravasation	IDA	26823460
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005540	Function	Hyaluronic acid binding	IBA
GO:0005540	Function	Hyaluronic acid binding	IDA	26823460
GO:0005540	Function	Hyaluronic acid binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	26823460
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10037799
GO:0006027	Process	Glycosaminoglycan catabolic process	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	TAS	10037799
GO:0009611	Process	Response to wounding	TAS	10037799
GO:0009653	Process	Anatomical structure morphogenesis	TAS	10037799
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10037799
GO:0030214	Process	Hyaluronan catabolic process	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0038023	Function	Signaling receptor activity	TAS	10037799
GO:0038024	Function	Cargo receptor activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071944	Component	Cell periphery	IEA

Other IDs

• MIM: 605702
• HGNC: 14687
• e!Ensembl: ENSG00000133800

Protein

• UniProt ID: Q9Y5Y7
• Protein name: Lymphatic vessel endothelial hyaluronic acid receptor 1 (LYVE-1) (Cell surface retention sequence-binding protein 1) (CRSBP-1) (Extracellular link domain-containing protein 1) (Hyaluronic acid receptor)
• Protein function: Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). M
• PDB: 8OS2, 8OXD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00193	Xlink	41 → 129	Extracellular link domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in endothelial cells lining lymphatic vessels. {ECO:0000269|PubMed:10037799, ECO:0000269|PubMed:26823460}.
• Sequence:

  MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEA
  CRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPV
  SRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPA
  PTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTAL
  LVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKT
  DKNPEESKSPSKTTVRCLEAEV

• Sequence length: 322

Pathways

Reactome:

Hyaluronan uptake and degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	10840043	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29550070		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	31649260		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	7536236		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11689016, 22562155, 29459011, 29741783		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25744065	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16229916, 7512791		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21737444	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28819375, 29207117		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	20028387	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26240291	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10810359		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	35328083	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29550070		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29151910		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29151910		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11719431, 19908110		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16820993, 17882649		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18181096, 29162097, 36172359	Associate	★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	16229916		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	29265937		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30655286	Associate	★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	31262327	Stimulate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	39596121	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	15677543	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35274800	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37073135, 37974098	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	33303070	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	LHGDN	16424896		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	15143338	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16507917, 28212584	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31250132		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31250132		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30257451	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	34307661	Associate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	16641275, 19260835		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14517843, 17087938, 21737444		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17087938		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11719431, 19908110		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11719431, 21737444		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28819375		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29207117	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37073135	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18181096, 21912471, 23539643, 27505247, 29207117	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28423532	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29409810		★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	30431105	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	18386053		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11689016, 22562155, 29459011, 29741783		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11719431		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28819375, 29207117		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10810359		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10502720, 10810359, 16033069, 16474850		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16820993, 17174733, 29968679, 31346234		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29151910		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11689016		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16142411, 27806339		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14676121		★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	30231303		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33350444	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29985167		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12759251, 14676121, 16142411, 16820993, 18058225, 22562155, 26202395, 26356813, 27251178, 28068246, 28576551, 28819375, 29207117, 29262593, 29741783, 30396932, 30959907		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25141859		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33787363, 36685529	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10810359		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	31554598		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	16077915		★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	25141859	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	25393639	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10502720, 10810359, 16033069, 16474850		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10840043, 16474850, 7512791	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	20861854		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	22801834		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29162051		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	29162051	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28569211		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18386053		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	19260835	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28081145, 31649260		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	33350444	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	26966180		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22544356		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16229916		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21912471	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22791956	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23238856, 23539643	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36315566	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	BEFREE	10834333, 17011702, 7633398		★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	25141859	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21179278	Inhibit	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	37955612	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34309635	Associate	★☆☆☆☆ Found in Text Mining only