CEACAM4 (CEA cell adhesion molecule 4)

Gene

• Entrez ID: 1089
• Gene name: CEA cell adhesion molecule 4
• Gene symbol: CEACAM4
• Synonyms (NCBI Gene): CGM7, CGM7_HUMAN, NCA
• Chromosome: 19
• Chromosome location: 19q13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1961785	hsa-miR-3125	CLIP-seq
MIRT1961786	hsa-miR-3916	CLIP-seq
MIRT2446787	hsa-miR-214	CLIP-seq
MIRT2446788	hsa-miR-3619-5p	CLIP-seq
MIRT2446789	hsa-miR-3925-3p	CLIP-seq
MIRT2446790	hsa-miR-4291	CLIP-seq
MIRT2446791	hsa-miR-761	CLIP-seq
MIRT2446792	hsa-miR-766	CLIP-seq
MIRT2446793	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002682	Process	Regulation of immune system process	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS	2050678
GO:0006909	Process	Phagocytosis	IDA	25567962
GO:0007165	Process	Signal transduction	IBA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	2050678
GO:1990782	Function	Protein tyrosine kinase binding	IBA

Other IDs

• MIM: 619159
• HGNC: 1816
• e!Ensembl: ENSG00000105352

Protein

• UniProt ID: O75871
• Protein name: Cell adhesion molecule CEACAM4 (Carcinoembryonic antigen CGM7) (Carcinoembryonic antigen-related cell adhesion molecule 4) (CEA cell adhesion molecule 4) (Non-specific cross-reacting antigen W236)
• Protein function: Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	39 → 141	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Granulocytes. {ECO:0000269|PubMed:2050678}.
• Sequence:

  MGPPSAAPRGGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGKDVLLLACNISE
  TIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSY
  TLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSRTG
  RASIQRDLREQPPPASTPGHGPSHRSTFSAPLPSPRTATPIYEELLYSDANIYCQIDHKA
  DVVS

• Sequence length: 244

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	7808000		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	2830274, 8460091		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	8460091		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	2067130, 2125040		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28084080		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	2067130, 2125040, 9250164		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	2067130		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34402193	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28084080		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1962152, 2067130, 2830274, 3390172, 9085168		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	2341397	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	1962152, 2125040, 9041239, 9085168		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	28084080		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28084080		★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	BEFREE	10980394		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	2480629	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12115552, 29687339		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	9085168		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	2332039		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	2067130, 9620446		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	28084080		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	25152032	Associate	★☆☆☆☆ Found in Text Mining only