EDDM3A (epididymal protein 3A)

Gene

• Entrez ID: 10876
• Gene name: Epididymal protein 3A
• Gene symbol: EDDM3A
• Synonyms (NCBI Gene): EP3A, FAM12A, HE3-ALPHA, HE3A, HE3ALPHA, RAM1
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT952285	hsa-miR-1207-5p	CLIP-seq
MIRT952286	hsa-miR-1244	CLIP-seq
MIRT952287	hsa-miR-141	CLIP-seq
MIRT952288	hsa-miR-1827	CLIP-seq
MIRT952289	hsa-miR-200a	CLIP-seq
MIRT952290	hsa-miR-3134	CLIP-seq
MIRT952291	hsa-miR-3148	CLIP-seq
MIRT952292	hsa-miR-3612	CLIP-seq
MIRT952293	hsa-miR-3918	CLIP-seq
MIRT952294	hsa-miR-3978	CLIP-seq
MIRT952295	hsa-miR-4259	CLIP-seq
MIRT952296	hsa-miR-4443	CLIP-seq
MIRT952297	hsa-miR-4534	CLIP-seq
MIRT952298	hsa-miR-4703-3p	CLIP-seq
MIRT952299	hsa-miR-4715-5p	CLIP-seq
MIRT952300	hsa-miR-4763-3p	CLIP-seq
MIRT952301	hsa-miR-4789-3p	CLIP-seq
MIRT952302	hsa-miR-4802-5p	CLIP-seq
MIRT952303	hsa-miR-570	CLIP-seq
MIRT952304	hsa-miR-642b	CLIP-seq
MIRT952305	hsa-miR-650	CLIP-seq
MIRT952306	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	TAS	7514008
GO:0007321	Process	Sperm displacement	TAS	7514008

Other IDs

• MIM: 611580
• HGNC: 16978
• e!Ensembl: ENSG00000181562

Protein

• UniProt ID: Q14507
• Protein name: Epididymal secretory protein E3-alpha (Human epididymis-specific protein 3-alpha) (HE3-alpha)
• Protein function: Possible function in sperm maturation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00074	RnaseA	29 → 140	Pancreatic ribonuclease	Domain

• Tissue specificity: TISSUE SPECIFICITY: Epididymis, with predominant expression in the corpus region. Moderately expressed in the vas deferens; only low levels are detectable in the caput and cauda regions.
• Sequence:

  MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEAL
  KGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSF
  SYIEFHCGVDGYVDNIEDLRIIEPISN

• Sequence length: 147

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Cyclocephaly	Cyclocephaly	BEFREE	28789611		★☆☆☆☆ Found in Text Mining only