Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10875
Gene name	Fibrinogen like 2
Gene symbol	FGL2
Synonyms (NCBI Gene)	T49pT49
Chromosome	7
Chromosome location	7q11.23
Summary	The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric comp

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018781	hsa-miR-335-5p	Microarray	18185580
MIRT030088	hsa-miR-26b-5p	Microarray	19088304
MIRT440643	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT440643	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT996284	hsa-miR-1267	CLIP-seq
MIRT996285	hsa-miR-132	CLIP-seq
MIRT996286	hsa-miR-212	CLIP-seq
MIRT996287	hsa-miR-296-3p	CLIP-seq
MIRT996288	hsa-miR-30a	CLIP-seq
MIRT996289	hsa-miR-30b	CLIP-seq
MIRT996290	hsa-miR-30c	CLIP-seq
MIRT996291	hsa-miR-30d	CLIP-seq
MIRT996292	hsa-miR-30e	CLIP-seq
MIRT996293	hsa-miR-3120-3p	CLIP-seq
MIRT996294	hsa-miR-3143	CLIP-seq
MIRT996295	hsa-miR-33a	CLIP-seq
MIRT996296	hsa-miR-33b	CLIP-seq
MIRT996297	hsa-miR-3973	CLIP-seq
MIRT996298	hsa-miR-409-3p	CLIP-seq
MIRT996299	hsa-miR-4273	CLIP-seq
MIRT996300	hsa-miR-4652-3p	CLIP-seq
MIRT996301	hsa-miR-4677-5p	CLIP-seq
MIRT996302	hsa-miR-4684-3p	CLIP-seq
MIRT996303	hsa-miR-4699-3p	CLIP-seq
MIRT996304	hsa-miR-4753-3p	CLIP-seq
MIRT996305	hsa-miR-4768-5p	CLIP-seq
MIRT996306	hsa-miR-513a-5p	CLIP-seq
MIRT996307	hsa-miR-518a-5p	CLIP-seq
MIRT996308	hsa-miR-527	CLIP-seq
MIRT996309	hsa-miR-543	CLIP-seq
MIRT996310	hsa-miR-548a-5p	CLIP-seq
MIRT996311	hsa-miR-548ab	CLIP-seq
MIRT996312	hsa-miR-548ak	CLIP-seq
MIRT996313	hsa-miR-548b-5p	CLIP-seq
MIRT996314	hsa-miR-548c-5p	CLIP-seq
MIRT996315	hsa-miR-548d-5p	CLIP-seq
MIRT996316	hsa-miR-548h	CLIP-seq
MIRT996317	hsa-miR-548i	CLIP-seq
MIRT996318	hsa-miR-548j	CLIP-seq
MIRT996319	hsa-miR-548w	CLIP-seq
MIRT996320	hsa-miR-548y	CLIP-seq
MIRT996321	hsa-miR-559	CLIP-seq
MIRT996322	hsa-miR-619	CLIP-seq
MIRT1995381	hsa-miR-122	CLIP-seq
MIRT1995382	hsa-miR-1287	CLIP-seq
MIRT1995383	hsa-miR-150	CLIP-seq
MIRT1995384	hsa-miR-24	CLIP-seq
MIRT1995385	hsa-miR-3135b	CLIP-seq
MIRT1995386	hsa-miR-3159	CLIP-seq
MIRT1995387	hsa-miR-4264	CLIP-seq
MIRT1995388	hsa-miR-4284	CLIP-seq
MIRT1995389	hsa-miR-4328	CLIP-seq
MIRT1995390	hsa-miR-4438	CLIP-seq
MIRT996305	hsa-miR-4768-5p	CLIP-seq
MIRT1995391	hsa-miR-4772-3p	CLIP-seq
MIRT1995392	hsa-miR-5095	CLIP-seq
MIRT1995393	hsa-miR-562	CLIP-seq
MIRT1995394	hsa-miR-576-3p	CLIP-seq
MIRT1995395	hsa-miR-622	CLIP-seq
MIRT1995396	hsa-miR-944	CLIP-seq
MIRT1995381	hsa-miR-122	CLIP-seq
MIRT2229453	hsa-miR-1236	CLIP-seq
MIRT2229454	hsa-miR-1305	CLIP-seq
MIRT1995383	hsa-miR-150	CLIP-seq
MIRT2229455	hsa-miR-1976	CLIP-seq
MIRT1995384	hsa-miR-24	CLIP-seq
MIRT1995386	hsa-miR-3159	CLIP-seq
MIRT2229456	hsa-miR-3187-3p	CLIP-seq
MIRT2229457	hsa-miR-3617	CLIP-seq
MIRT2229458	hsa-miR-3663-5p	CLIP-seq
MIRT2229459	hsa-miR-371-5p	CLIP-seq
MIRT2229460	hsa-miR-371b-5p	CLIP-seq
MIRT1995387	hsa-miR-4264	CLIP-seq
MIRT2229461	hsa-miR-4279	CLIP-seq
MIRT1995388	hsa-miR-4284	CLIP-seq
MIRT1995389	hsa-miR-4328	CLIP-seq
MIRT2229462	hsa-miR-4435	CLIP-seq
MIRT1995390	hsa-miR-4438	CLIP-seq
MIRT2229463	hsa-miR-4701-5p	CLIP-seq
MIRT2229464	hsa-miR-4722-3p	CLIP-seq
MIRT2229465	hsa-miR-4755-3p	CLIP-seq
MIRT996305	hsa-miR-4768-5p	CLIP-seq
MIRT1995391	hsa-miR-4772-3p	CLIP-seq
MIRT2229466	hsa-miR-494	CLIP-seq
MIRT1995392	hsa-miR-5095	CLIP-seq
MIRT2229467	hsa-miR-548s	CLIP-seq
MIRT1995393	hsa-miR-562	CLIP-seq
MIRT2229468	hsa-miR-588	CLIP-seq
MIRT1995395	hsa-miR-622	CLIP-seq
MIRT2229469	hsa-miR-641	CLIP-seq
MIRT1995392	hsa-miR-5095	CLIP-seq
MIRT2428937	hsa-miR-3144-3p	CLIP-seq
MIRT2428938	hsa-miR-556-5p	CLIP-seq
MIRT2428939	hsa-miR-875-5p	CLIP-seq
MIRT2428937	hsa-miR-3144-3p	CLIP-seq
MIRT2428938	hsa-miR-556-5p	CLIP-seq
MIRT2428939	hsa-miR-875-5p	CLIP-seq
MIRT2449685	hsa-miR-4735-5p	CLIP-seq
MIRT2449686	hsa-miR-4775	CLIP-seq
MIRT2449687	hsa-miR-590-3p	CLIP-seq
MIRT1995381	hsa-miR-122	CLIP-seq
MIRT1995382	hsa-miR-1287	CLIP-seq
MIRT1995384	hsa-miR-24	CLIP-seq
MIRT2533356	hsa-miR-3065-5p	CLIP-seq
MIRT1995385	hsa-miR-3135b	CLIP-seq
MIRT1995387	hsa-miR-4264	CLIP-seq
MIRT1995388	hsa-miR-4284	CLIP-seq
MIRT1995390	hsa-miR-4438	CLIP-seq
MIRT2449685	hsa-miR-4735-5p	CLIP-seq
MIRT1995391	hsa-miR-4772-3p	CLIP-seq
MIRT2449686	hsa-miR-4775	CLIP-seq
MIRT1995392	hsa-miR-5095	CLIP-seq
MIRT2449687	hsa-miR-590-3p	CLIP-seq
MIRT1995395	hsa-miR-622	CLIP-seq
MIRT1995381	hsa-miR-122	CLIP-seq
MIRT1995382	hsa-miR-1287	CLIP-seq
MIRT1995384	hsa-miR-24	CLIP-seq
MIRT2533356	hsa-miR-3065-5p	CLIP-seq
MIRT1995385	hsa-miR-3135b	CLIP-seq
MIRT1995388	hsa-miR-4284	CLIP-seq
MIRT1995390	hsa-miR-4438	CLIP-seq
MIRT1995392	hsa-miR-5095	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SP1	Unknown	11170750

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IEA
GO:0002605	Process	Negative regulation of dendritic cell antigen processing and presentation	IEA
GO:0002617	Process	Negative regulation of macrophage antigen processing and presentation	IEA
GO:0005201	Function	Extracellular matrix structural constituent	RCA	28327460
GO:0005515	Function	Protein binding	IPI	35156780
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005577	Component	Fibrinogen complex	TAS	7642106
GO:0005615	Component	Extracellular space	IBA
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	IBA
GO:0043381	Process	Negative regulation of memory T cell differentiation	IEA
GO:0050687	Process	Negative regulation of defense response to virus	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
605351	3696	ENSG00000127951

Q14314

Protein name

Fibroleukin (Fibrinogen-like protein 2) (pT49)

Protein function

May play a role in physiologic lymphocyte functions at mucosal sites.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00147	Fibrinogen_C	209 → 435	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Constitutively expressed in cytotoxic T-cells.

Sequence

MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVS
LPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTG
APGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANL
TFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEV
YCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
RIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPD
KDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGG
YKSSFKEAKMMIRPKHFKP

Sequence length

439

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (49)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	29054965, 30884164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	36755239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	29756667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30683885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32716910	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18715028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28656005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28978925	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20438701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28487604, 28713999, 29441068, 31743856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24287641	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25129313, 29441068, 31286589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25129313, 38036953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	30419833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28978925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24287641	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	31743856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	30884164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	17374397		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31073344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30098304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33323552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	16437596, 25200905, 28494352, 30619295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	35029030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28656005, 30683885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25971300, 28656005, 30683885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25971300, 29947810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32716910	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31580221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31580221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	31580221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30683885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24287641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28487604, 28713999, 29441068, 31743856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18715028, 22925132, 27163335, 31409352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25303152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28656005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22925132, 25971300, 29947810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	32596316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29128901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	19423547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22925132, 25496996, 25971300, 27163335, 28656005, 28978925, 30419833, 30683885, 31409352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32188105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29054965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34393665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	19423547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	19423547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	31653482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	32713274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FGL2 (fibrinogen like 2)