Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10868
Gene name	Ubiquitin specific peptidase 20
Gene symbol	USP20
Synonyms (NCBI Gene)	LSFR3AVDU2hVDU2
Chromosome	9
Chromosome location	9q34.11
Summary	This gene encodes a ubiquitin specific processing protease that was first identified as a substrate of the VHL (von Hippel-Lindau disease) protein E3 ubiquitin ligase complex. In addition to being ubiquitinated by the VHL-E3 ligase complex, this enzyme de

Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030042	hsa-miR-26b-5p	Microarray	19088304
MIRT1477931	hsa-miR-125a-5p	CLIP-seq
MIRT1477932	hsa-miR-125b	CLIP-seq
MIRT1477933	hsa-miR-3136-3p	CLIP-seq
MIRT1477934	hsa-miR-3176	CLIP-seq
MIRT1477935	hsa-miR-345	CLIP-seq
MIRT1477936	hsa-miR-3922-3p	CLIP-seq
MIRT1477937	hsa-miR-4319	CLIP-seq
MIRT1477938	hsa-miR-4522	CLIP-seq
MIRT1477939	hsa-miR-4732-3p	CLIP-seq
MIRT1477940	hsa-miR-670	CLIP-seq
MIRT1477941	hsa-miR-217	CLIP-seq
MIRT1477942	hsa-miR-4418	CLIP-seq
MIRT1477943	hsa-miR-509-3-5p	CLIP-seq
MIRT1477944	hsa-miR-509-5p	CLIP-seq
MIRT2143965	hsa-miR-214	CLIP-seq
MIRT2143966	hsa-miR-3619-5p	CLIP-seq
MIRT2143967	hsa-miR-4291	CLIP-seq
MIRT2143968	hsa-miR-761	CLIP-seq
MIRT2364202	hsa-miR-1915	CLIP-seq
MIRT2364203	hsa-miR-2115	CLIP-seq
MIRT2364204	hsa-miR-3622a-3p	CLIP-seq
MIRT2364205	hsa-miR-3622b-3p	CLIP-seq
MIRT2364206	hsa-miR-4314	CLIP-seq
MIRT2364207	hsa-miR-4437	CLIP-seq
MIRT2364208	hsa-miR-4661-3p	CLIP-seq
MIRT2364209	hsa-miR-4685-5p	CLIP-seq
MIRT2364210	hsa-miR-4726-3p	CLIP-seq
MIRT2364211	hsa-miR-513a-3p	CLIP-seq
MIRT2364212	hsa-miR-516a-3p	CLIP-seq
MIRT2364213	hsa-miR-541	CLIP-seq
MIRT2364214	hsa-miR-654-5p	CLIP-seq
MIRT2396737	hsa-miR-4757-5p	CLIP-seq
MIRT2143965	hsa-miR-214	CLIP-seq
MIRT2143966	hsa-miR-3619-5p	CLIP-seq
MIRT2143967	hsa-miR-4291	CLIP-seq
MIRT2396738	hsa-miR-491-5p	CLIP-seq
MIRT2143968	hsa-miR-761	CLIP-seq
MIRT2657917	hsa-miR-1225-3p	CLIP-seq
MIRT2657918	hsa-miR-1275	CLIP-seq
MIRT2657919	hsa-miR-142-3p	CLIP-seq
MIRT2657920	hsa-miR-199a-3p	CLIP-seq
MIRT2657921	hsa-miR-199b-3p	CLIP-seq
MIRT2657922	hsa-miR-2355-5p	CLIP-seq
MIRT2657923	hsa-miR-3127-3p	CLIP-seq
MIRT2657924	hsa-miR-3129-5p	CLIP-seq
MIRT2657925	hsa-miR-3151	CLIP-seq
MIRT2657926	hsa-miR-3183	CLIP-seq
MIRT2657927	hsa-miR-3663-5p	CLIP-seq
MIRT2657928	hsa-miR-3675-5p	CLIP-seq
MIRT2657929	hsa-miR-4265	CLIP-seq
MIRT2657930	hsa-miR-4281	CLIP-seq
MIRT2657931	hsa-miR-4286	CLIP-seq
MIRT2657932	hsa-miR-4296	CLIP-seq
MIRT2657933	hsa-miR-4322	CLIP-seq
MIRT2657934	hsa-miR-4447	CLIP-seq
MIRT2657935	hsa-miR-4472	CLIP-seq
MIRT2657936	hsa-miR-451b	CLIP-seq
MIRT2657937	hsa-miR-4520a-5p	CLIP-seq
MIRT2657938	hsa-miR-4520b-5p	CLIP-seq
MIRT2657939	hsa-miR-4525	CLIP-seq
MIRT2657940	hsa-miR-4665-5p	CLIP-seq
MIRT2657941	hsa-miR-4723-3p	CLIP-seq
MIRT2657942	hsa-miR-4723-5p	CLIP-seq
MIRT2396738	hsa-miR-491-5p	CLIP-seq
MIRT2657943	hsa-miR-596	CLIP-seq
MIRT2657944	hsa-miR-625	CLIP-seq
MIRT2657945	hsa-miR-648	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IPI	19424180
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IMP	19424180
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	19424180, 26839314, 29487085
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS
GO:0005515	Function	Protein binding	IPI	19615732, 23166351, 23486064, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IC	26839314, 27801882, 29487085
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005813	Component	Centrosome	IDA	23486064
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	26839314
GO:0007399	Process	Nervous system development	IBA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IBA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IMP	19424180
GO:0010508	Process	Positive regulation of autophagy	IDA	29487085
GO:0010508	Process	Positive regulation of autophagy	IDA	29487085
GO:0016579	Process	Protein deubiquitination	IDA	19424180
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	26839314
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	26839314
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0070536	Process	Protein K63-linked deubiquitination	IDA	19424180
GO:0070536	Process	Protein K63-linked deubiquitination	IEA
GO:0071108	Process	Protein K48-linked deubiquitination	IDA	19424180
GO:0071108	Process	Protein K48-linked deubiquitination	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	21074459
GO:0140374	Process	Antiviral innate immune response	IDA	27801882

MIM	HGNC	e!Ensembl
615143	12619	ENSG00000136878

Q9Y2K6

Protein name

Ubiquitin carboxyl-terminal hydrolase 20 (EC 3.4.19.12) (Deubiquitinating enzyme 20) (Ubiquitin thioesterase 20) (Ubiquitin-specific-processing protease 20) (VHL-interacting deubiquitinating enzyme 2) (hVDU2)

Protein function

Deubiquitinating enzyme that plays a role in many cellular processes including autophagy, cellular antiviral response or membrane protein biogenesis (PubMed:27801882, PubMed:29487085). Attenuates TLR4-mediated NF-kappa-B signaling by cooperating

PDB

6KCZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02148	zf-UBP	30 → 95	Zn-finger in ubiquitin-hydrolases and other protein	Domain
PF00443	UCH	145 → 682	Ubiquitin carboxyl-terminal hydrolase	Family
PF06337	DUSP	649 → 780	DUSP domain	Domain
PF06337	DUSP	815 → 891	DUSP domain	Domain

Sequence

MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADH
STIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGR
GGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDDQ
PAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPS
YVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIP
GKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLE
DCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKIN
SHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFD
DQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKF
NTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVC
SICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPP
GPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPEN
LHGEQKIEAETRAV

Sequence length

914

Interactions

View interactions

	Reactome
			Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BONE NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	30354204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30354204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32943575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28350092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35077391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

USP20 (ubiquitin specific peptidase 20)