Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10865
Gene name	AT-rich interaction domain 5A
Gene symbol	ARID5A
Synonyms (NCBI Gene)	MRF-1MRF1RP11-363D14
Chromosome	2
Chromosome location	2q11.2
Summary	Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 [PubMed 15640446]).[supplied by OMIM

Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043168	hsa-miR-324-5p	CLASH	23622248
MIRT796917	hsa-miR-326	CLIP-seq
MIRT796918	hsa-miR-330-5p	CLIP-seq
MIRT796919	hsa-miR-34a	CLIP-seq
MIRT796920	hsa-miR-34c-5p	CLIP-seq
MIRT796921	hsa-miR-4300	CLIP-seq
MIRT796922	hsa-miR-449a	CLIP-seq
MIRT796923	hsa-miR-449b	CLIP-seq
MIRT796924	hsa-miR-4667-5p	CLIP-seq
MIRT796925	hsa-miR-4700-5p	CLIP-seq
MIRT796926	hsa-miR-486-3p	CLIP-seq
MIRT796927	hsa-miR-572	CLIP-seq
MIRT796928	hsa-miR-637	CLIP-seq
MIRT796929	hsa-miR-920	CLIP-seq
MIRT1935294	hsa-miR-1343	CLIP-seq
MIRT1935295	hsa-miR-3132	CLIP-seq
MIRT796917	hsa-miR-326	CLIP-seq
MIRT796918	hsa-miR-330-5p	CLIP-seq
MIRT796919	hsa-miR-34a	CLIP-seq
MIRT796920	hsa-miR-34c-5p	CLIP-seq
MIRT1935296	hsa-miR-4269	CLIP-seq
MIRT796921	hsa-miR-4300	CLIP-seq
MIRT796922	hsa-miR-449a	CLIP-seq
MIRT796923	hsa-miR-449b	CLIP-seq
MIRT796924	hsa-miR-4667-5p	CLIP-seq
MIRT1935297	hsa-miR-4690-5p	CLIP-seq
MIRT796925	hsa-miR-4700-5p	CLIP-seq
MIRT796926	hsa-miR-486-3p	CLIP-seq
MIRT796927	hsa-miR-572	CLIP-seq
MIRT796928	hsa-miR-637	CLIP-seq
MIRT796929	hsa-miR-920	CLIP-seq
MIRT796917	hsa-miR-326	CLIP-seq
MIRT796918	hsa-miR-330-5p	CLIP-seq
MIRT796919	hsa-miR-34a	CLIP-seq
MIRT796920	hsa-miR-34c-5p	CLIP-seq
MIRT796921	hsa-miR-4300	CLIP-seq
MIRT796922	hsa-miR-449a	CLIP-seq
MIRT796923	hsa-miR-449b	CLIP-seq
MIRT796924	hsa-miR-4667-5p	CLIP-seq
MIRT796925	hsa-miR-4700-5p	CLIP-seq
MIRT796926	hsa-miR-486-3p	CLIP-seq
MIRT796927	hsa-miR-572	CLIP-seq
MIRT796928	hsa-miR-637	CLIP-seq
MIRT796929	hsa-miR-920	CLIP-seq
MIRT796917	hsa-miR-326	CLIP-seq
MIRT796918	hsa-miR-330-5p	CLIP-seq
MIRT796919	hsa-miR-34a	CLIP-seq
MIRT796920	hsa-miR-34c-5p	CLIP-seq
MIRT796921	hsa-miR-4300	CLIP-seq
MIRT796922	hsa-miR-449a	CLIP-seq
MIRT796923	hsa-miR-449b	CLIP-seq
MIRT796924	hsa-miR-4667-5p	CLIP-seq
MIRT796925	hsa-miR-4700-5p	CLIP-seq
MIRT796926	hsa-miR-486-3p	CLIP-seq
MIRT796927	hsa-miR-572	CLIP-seq
MIRT796928	hsa-miR-637	CLIP-seq
MIRT796929	hsa-miR-920	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15941852
GO:0000976	Function	Transcription cis-regulatory region binding	IBA
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	15640446
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	IDA	15941852
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	15941852, 16713569, 23275563, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008134	Function	Transcription factor binding	IDA	15941852
GO:0030331	Function	Nuclear estrogen receptor binding	IDA	15941852
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0035613	Function	RNA stem-loop binding	IEA
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IDA	32209697
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043565	Function	Sequence-specific DNA binding	IDA	15640446
GO:0045087	Process	Innate immune response	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	TAS	15640446
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046965	Function	Nuclear retinoid X receptor binding	IDA	15941852
GO:0046966	Function	Nuclear thyroid hormone receptor binding	IDA	15941852
GO:0050681	Function	Nuclear androgen receptor binding	IDA	15941852
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	15941852
GO:1905870	Process	Positive regulation of 3'-UTR-mediated mRNA stabilization	IMP	32209697
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	IEA
GO:2000556	Process	Positive regulation of T-helper 1 cell cytokine production	IEA

MIM	HGNC	e!Ensembl
611583	17361	ENSG00000196843

Q03989

Protein name

AT-rich interactive domain-containing protein 5A (ARID domain-containing protein 5A) (Modulator recognition factor 1) (MRF-1)

Protein function

DNA-binding protein that may regulate transcription and act as a repressor by binding to AT-rich stretches in the promoter region of target genes (PubMed:8649988). May positively regulate chondrocyte-specific transcription such as of COL2A1 in c

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01388	ARID	57 → 142	ARID/BRIGHT DNA binding domain	Domain

Sequence

MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGEREEEQEREEEQA
FLVSLYKFMKERHTPIERVPHLGFKQINLWKIYKAVEKLGAYELVTGRRLWKNVYDELGG
SPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPK
KAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYK
RLLSSFYCKGTHGIMSPLAKKKLLAQVSKVEALQCQEEGCRHGAEPQASPAVHLPESPQS
PKGLTENSRHRLTPQEGLQAPGGSLREEAQAGPCPAAPIFKGCFYTHPTEVLKPVSQHPR
DFFSRLKDGVLLGPPGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGILYPKPKACWVSP
MAKVPAESPTLPPTFPSSPGLGSKRSLEEEGAAHSGKRLRAVSPFLKEADAKKCGAKPAG
SGLVSCLLGPALGPVPPEAYRGTMLHCPLNFTGTPGPLKGQAALPFSPLVIPAFPAHFLA
TAGPSPMAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL

Sequence length

594

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARID5A-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28168301, 28379390, 29244194, 29701145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37129704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	28379390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33592583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32548260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31289228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	31289228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34633095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28379390		★★★★★ ★☆☆☆☆ Found in Text Mining only

ARID5A (AT-rich interaction domain 5A)