Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10864
Gene name	Solute carrier family 22 member 7
Gene symbol	SLC22A7
Synonyms (NCBI Gene)	NLTOAT2hOAT11
Chromosome	6
Chromosome location	6p21.1
Summary	The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membr

Show/Hide all (14)

miRTarBase ID	miRNA	Experiments
MIRT1354593	hsa-miR-3157-5p	CLIP-seq
MIRT1354594	hsa-miR-4452	CLIP-seq
MIRT1354595	hsa-miR-4474-3p	CLIP-seq
MIRT2104949	hsa-miR-4685-5p	CLIP-seq
MIRT2623871	hsa-miR-1915	CLIP-seq
MIRT2623872	hsa-miR-361-5p	CLIP-seq
MIRT2623873	hsa-miR-4436b-3p	CLIP-seq
MIRT2104949	hsa-miR-4685-5p	CLIP-seq
MIRT2623874	hsa-miR-4771	CLIP-seq
MIRT2623871	hsa-miR-1915	CLIP-seq
MIRT2623872	hsa-miR-361-5p	CLIP-seq
MIRT2623873	hsa-miR-4436b-3p	CLIP-seq
MIRT2104949	hsa-miR-4685-5p	CLIP-seq
MIRT2623874	hsa-miR-4771	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15846844
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	18216183, 28112518
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9650585
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11327718, 11907186, 25904762, 26377792, 28945155
GO:0008514	Function	Organic anion transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IMP	21446918
GO:0008514	Function	Organic anion transmembrane transporter activity	TAS
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IEA
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IDA	11327718
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IEA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	ISS
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	TAS	9650585
GO:0015711	Process	Organic anion transport	IEA
GO:0015711	Process	Organic anion transport	TAS	9650585
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0015732	Process	Prostaglandin transport	IEA
GO:0015742	Process	Alpha-ketoglutarate transport	IDA	11327718
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9650585
GO:0016323	Component	Basolateral plasma membrane	IDA	25904762, 27053689
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	25904762
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IDA	18216183, 25904762, 26377792, 28945155
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
604995	10971	ENSG00000137204

Q9Y694

Protein name

Solute carrier family 22 member 7 (Novel liver transporter) (NLT) (Organic anion transporter 2) (hOAT2)

Protein function

[Isoform 2]: Functions as a Na(+)-independent bidirectional multispecific transporter (PubMed:11327718, PubMed:18216183, PubMed:21446918, PubMed:28945155). Contributes to the renal and hepatic elimination of endogenous organic compounds from the

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	75 → 481	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in liver and kidney (PubMed:11327718, PubMed:18216183, PubMed:21446918, PubMed:25904762). In kidney, expressed in proximal tubular cells (PubMed:25904762). Also expressed in pancreas, small intestine, spinal cord, lung

Sequence

MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCALPGAPANFSH
QDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYD
HSEFSSTIATESQWDLVCEQKGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYV
STLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRTVAGVLSSTFW
TGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPESARWLLTQGHVKEAHRYLLH
CARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSYLDLFRTPRLRHISLCCVVVWFGVNFS
YYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGTLLGTALAFGTR
LLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLA
PLAALLDGVWLSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE
MPMKQVQN

Sequence length

548

Interactions

View interactions

	KEGG		Reactome
	Bile secretion		Organic anion transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32461965	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37657024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	19293444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	15684063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34599518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25710042, 29534510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25710042, 29534510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	15319464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	30487518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23543312		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC22A7 (solute carrier family 22 member 7)