LILRB1 (leukocyte immunoglobulin like receptor B1)

Gene

• Entrez ID: 10859
• Gene name: Leukocyte immunoglobulin like receptor B1
• Gene symbol: LILRB1
• Synonyms (NCBI Gene): CD85J, ILT-2, ILT2, LIR-1, LIR1, MIR-7, MIR7, PIR-B, PIRB
• Chromosome: 19
• Chromosome location: 19q13.42
• Summary: This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT609970	hsa-miR-8485	HITS-CLIP	21572407
MIRT609969	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT609968	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT609967	hsa-miR-603	HITS-CLIP	21572407
MIRT625538	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT609965	hsa-miR-3941	HITS-CLIP	21572407
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707189	hsa-miR-377-3p	HITS-CLIP	21572407
MIRT707188	hsa-miR-5096	HITS-CLIP	21572407
MIRT707187	hsa-miR-335-3p	HITS-CLIP	21572407
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT625538	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	21572407
MIRT609969	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT609968	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT609967	hsa-miR-603	HITS-CLIP	21572407
MIRT625538	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT609965	hsa-miR-3941	HITS-CLIP	21572407
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707189	hsa-miR-377-3p	HITS-CLIP	21572407
MIRT707188	hsa-miR-5096	HITS-CLIP	21572407
MIRT707187	hsa-miR-335-3p	HITS-CLIP	21572407
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT625538	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609972	hsa-miR-3662	HITS-CLIP	23824327
MIRT609971	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT609970	hsa-miR-8485	HITS-CLIP	23824327
MIRT609969	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609968	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609967	hsa-miR-603	HITS-CLIP	23824327
MIRT609966	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT609965	hsa-miR-3941	HITS-CLIP	23824327
MIRT609964	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT609963	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT1109338	hsa-miR-4496	CLIP-seq
MIRT1109339	hsa-miR-579	CLIP-seq
MIRT1109340	hsa-miR-664	CLIP-seq
MIRT2030382	hsa-miR-106a	CLIP-seq
MIRT2030383	hsa-miR-106b	CLIP-seq
MIRT2030384	hsa-miR-1234	CLIP-seq
MIRT2030385	hsa-miR-1287	CLIP-seq
MIRT2030386	hsa-miR-150	CLIP-seq
MIRT2030387	hsa-miR-17	CLIP-seq
MIRT2030388	hsa-miR-1913	CLIP-seq
MIRT2030389	hsa-miR-1976	CLIP-seq
MIRT2030390	hsa-miR-20a	CLIP-seq
MIRT2030391	hsa-miR-20b	CLIP-seq
MIRT2030392	hsa-miR-302a	CLIP-seq
MIRT2030393	hsa-miR-302b	CLIP-seq
MIRT2030394	hsa-miR-302c	CLIP-seq
MIRT2030395	hsa-miR-302d	CLIP-seq
MIRT2030396	hsa-miR-302e	CLIP-seq
MIRT2030397	hsa-miR-3135b	CLIP-seq
MIRT2030398	hsa-miR-324-3p	CLIP-seq
MIRT2030399	hsa-miR-372	CLIP-seq
MIRT2030400	hsa-miR-373	CLIP-seq
MIRT2030401	hsa-miR-4279	CLIP-seq
MIRT2030402	hsa-miR-4466	CLIP-seq
MIRT2030403	hsa-miR-4707-3p	CLIP-seq
MIRT2030404	hsa-miR-4722-3p	CLIP-seq
MIRT2030405	hsa-miR-512-3p	CLIP-seq
MIRT2030406	hsa-miR-519d	CLIP-seq
MIRT2030407	hsa-miR-520a-3p	CLIP-seq
MIRT2030408	hsa-miR-520b	CLIP-seq
MIRT2030409	hsa-miR-520c-3p	CLIP-seq
MIRT2030410	hsa-miR-520d-3p	CLIP-seq
MIRT2030411	hsa-miR-520e	CLIP-seq
MIRT2030412	hsa-miR-520g	CLIP-seq
MIRT2030413	hsa-miR-520h	CLIP-seq
MIRT2030414	hsa-miR-675	CLIP-seq
MIRT2030415	hsa-miR-93	CLIP-seq
MIRT2030386	hsa-miR-150	CLIP-seq
MIRT2030389	hsa-miR-1976	CLIP-seq
MIRT2030397	hsa-miR-3135b	CLIP-seq
MIRT2261107	hsa-miR-345	CLIP-seq
MIRT2030401	hsa-miR-4279	CLIP-seq
MIRT2261108	hsa-miR-4292	CLIP-seq
MIRT2261109	hsa-miR-4308	CLIP-seq
MIRT2261110	hsa-miR-4438	CLIP-seq
MIRT2261111	hsa-miR-498	CLIP-seq
MIRT2261112	hsa-miR-5095	CLIP-seq
MIRT2453026	hsa-miR-1289	CLIP-seq
MIRT2453027	hsa-miR-143	CLIP-seq
MIRT2030386	hsa-miR-150	CLIP-seq
MIRT2453028	hsa-miR-185	CLIP-seq
MIRT2030389	hsa-miR-1976	CLIP-seq
MIRT2453029	hsa-miR-2278	CLIP-seq
MIRT2030397	hsa-miR-3135b	CLIP-seq
MIRT2453030	hsa-miR-3198	CLIP-seq
MIRT2453031	hsa-miR-3652	CLIP-seq
MIRT2030401	hsa-miR-4279	CLIP-seq
MIRT2453032	hsa-miR-4287	CLIP-seq
MIRT2261108	hsa-miR-4292	CLIP-seq
MIRT2453033	hsa-miR-4294	CLIP-seq
MIRT2453034	hsa-miR-4306	CLIP-seq
MIRT2261109	hsa-miR-4308	CLIP-seq
MIRT2453035	hsa-miR-4309	CLIP-seq
MIRT2453036	hsa-miR-4430	CLIP-seq
MIRT2453037	hsa-miR-4469	CLIP-seq
MIRT2453038	hsa-miR-4534	CLIP-seq
MIRT2453039	hsa-miR-4644	CLIP-seq
MIRT2453040	hsa-miR-4685-3p	CLIP-seq
MIRT2030404	hsa-miR-4722-3p	CLIP-seq
MIRT2453041	hsa-miR-4755-3p	CLIP-seq
MIRT2261111	hsa-miR-498	CLIP-seq
MIRT2453042	hsa-miR-642a	CLIP-seq
MIRT2030389	hsa-miR-1976	CLIP-seq
MIRT2030401	hsa-miR-4279	CLIP-seq
MIRT2261108	hsa-miR-4292	CLIP-seq
MIRT2261109	hsa-miR-4308	CLIP-seq
MIRT2030404	hsa-miR-4722-3p	CLIP-seq
MIRT2261111	hsa-miR-498	CLIP-seq
MIRT2030389	hsa-miR-1976	CLIP-seq
MIRT2561102	hsa-miR-3149	CLIP-seq
MIRT2261107	hsa-miR-345	CLIP-seq
MIRT2561103	hsa-miR-4267	CLIP-seq
MIRT2030401	hsa-miR-4279	CLIP-seq
MIRT2261108	hsa-miR-4292	CLIP-seq
MIRT2261109	hsa-miR-4308	CLIP-seq
MIRT2561104	hsa-miR-4715-3p	CLIP-seq
MIRT2030404	hsa-miR-4722-3p	CLIP-seq
MIRT2561105	hsa-miR-4735-5p	CLIP-seq
MIRT2261111	hsa-miR-498	CLIP-seq
MIRT2561106	hsa-miR-590-3p	CLIP-seq
MIRT2030389	hsa-miR-1976	CLIP-seq
MIRT2261107	hsa-miR-345	CLIP-seq
MIRT2030401	hsa-miR-4279	CLIP-seq
MIRT2261108	hsa-miR-4292	CLIP-seq
MIRT2261109	hsa-miR-4308	CLIP-seq
MIRT2261111	hsa-miR-498	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TRERF1	Repression	18652845

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IDA	24052308
GO:0001915	Process	Negative regulation of T cell mediated cytotoxicity	IDA	21213105
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	18398485
GO:0002250	Process	Adaptive immune response	IEA
GO:0002309	Process	T cell proliferation involved in immune response	IDA	18094328
GO:0002376	Process	Immune system process	IEA
GO:0002719	Process	Negative regulation of cytokine production involved in immune response	IDA	18094328
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0002767	Process	Immune response-inhibiting cell surface receptor signaling pathway	NAS	18550825
GO:0002774	Process	Fc receptor mediated inhibitory signaling pathway	IDA	9842885
GO:0005515	Function	Protein binding	IPI	11169396, 12853576, 12874224, 16455647, 18802077, 19583775, 24018270, 28636952
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IDA	15585844
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IDA	18802077
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0008157	Function	Protein phosphatase 1 binding	IPI	9285411, 9842885, 11907092, 18802077
GO:0009615	Process	Response to virus	IDA	9285411, 17869268, 18094328
GO:0009897	Component	External side of plasma membrane	IDA	9285411, 15585844, 17869268, 18094328, 18684926, 21233315, 21551166
GO:0010628	Process	Positive regulation of gene expression	IDA	18094328
GO:0014063	Process	Negative regulation of serotonin secretion	IDA	11907092
GO:0016020	Component	Membrane	IEA
GO:0023025	Function	MHC class Ib protein complex binding	IDA	17056715, 28636952
GO:0023029	Function	MHC class Ib protein binding	IDA	11169396
GO:0030107	Function	HLA-A specific inhibitory MHC class I receptor activity	IDA	18684926
GO:0030109	Function	HLA-B specific inhibitory MHC class I receptor activity	IDA	11907092
GO:0031623	Process	Receptor internalization	TAS	17869268
GO:0032393	Function	MHC class I receptor activity	IDA	9285411, 9842885, 17869268, 18094328, 18398485, 18802077, 21213105, 21233315
GO:0032394	Function	MHC class Ib receptor activity	IDA	24453251
GO:0032396	Function	Inhibitory MHC class I receptor activity	IBA
GO:0032688	Process	Negative regulation of interferon-beta production	IDA	21213105
GO:0032689	Process	Negative regulation of type II interferon production	IDA	17869268, 18684926
GO:0032693	Process	Negative regulation of interleukin-10 production	IDA	18094328
GO:0032695	Process	Negative regulation of interleukin-12 production	IDA	18094328
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	18684926
GO:0032729	Process	Positive regulation of type II interferon production	IDA	11907092, 15585844
GO:0032945	Process	Negative regulation of mononuclear cell proliferation	IDA	21551166
GO:0042130	Process	Negative regulation of T cell proliferation	IDA	15585844
GO:0042169	Function	SH2 domain binding	IDA	11907092
GO:0042288	Function	MHC class I protein binding	IDA	9842885, 18094328, 18802077, 21213105
GO:0042288	Function	MHC class I protein binding	IMP	18398485, 21233315
GO:0042288	Function	MHC class I protein binding	IPI	9285411, 17869268, 18094328, 19124746, 20702625
GO:0042803	Function	Protein homodimerization activity	IPI	21213105
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21551166
GO:0045786	Process	Negative regulation of cell cycle	IDA	21551166
GO:0045806	Process	Negative regulation of endocytosis	IDA	18094328
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	18550825
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	12874224, 18398485
GO:0046636	Process	Negative regulation of alpha-beta T cell activation	IDA	21213105
GO:0051607	Process	Defense response to virus	IDA	15585844
GO:0051926	Process	Negative regulation of calcium ion transport	IDA	9842885
GO:0060907	Process	Positive regulation of macrophage cytokine production	IDA	19304799
GO:0071222	Process	Cellular response to lipopolysaccharide	IEP	18094328
GO:0071635	Process	Negative regulation of transforming growth factor beta production	IDA	18094328
GO:0097028	Process	Dendritic cell differentiation	IEP	18094328
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IBA
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IDA	18094328
GO:2001186	Process	Negative regulation of CD8-positive, alpha-beta T cell activation	IDA	21213105
GO:2001189	Process	Negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IDA	18094328
GO:2001193	Process	Positive regulation of gamma-delta T cell activation involved in immune response	IDA	21233315
GO:2001199	Process	Negative regulation of dendritic cell differentiation	IMP	18684926
GO:2001205	Process	Negative regulation of osteoclast development	IDA	18802077

Other IDs

• MIM: 604811
• HGNC: 6605
• e!Ensembl: ENSG00000104972

Protein

• UniProt ID: Q8NHL6
• Protein name: Leukocyte immunoglobulin-like receptor subfamily B member 1 (LIR-1) (Leukocyte immunoglobulin-like receptor 1) (CD85 antigen-like family member J) (Immunoglobulin-like transcript 2) (ILT-2) (Monocyte/macrophage immunoglobulin-like receptor 7) (MIR-7) (CD
• Protein function: Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G and HLA-F alleles (PubMed:16455647, PubMed:28636952). Receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding results in inh
• PDB: 1G0X, 1P7Q, 1UFU, 1UGN, 1VDG, 3D2U, 4LL9, 4NO0, 5KNM, 6AEE, 6EWA, 6EWC, 6EWO, 6K60, 6ZDX, 7KFK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	28 → 118	Immunoglobulin domain	Domain
  PF00047	ig	329 → 410	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in B cells, monocytes and various dendritic cell (DC) subsets including myeloid, plasmacytoid and tolerogenic DCs (at protein level) (PubMed:20448110, PubMed:24453251, PubMed:9285411, PubMed:9842885). Expressed in decidual ma
• Sequence:

  MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRL
  YREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTG
  AYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRA
  IFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEE
  TLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGA
  HNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKE
  GAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVS
  GPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLF
  LILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQ
  PEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMD
  TEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH

• Sequence length: 650

Pathways

KEGG:

Osteoclast differentiation
B cell receptor signaling pathway

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Melanoma	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	27380024		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	24854610, 29332987		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28618418		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	29295890		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	25584614, 31736877		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29564561		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	23007163		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	26452132		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36010613	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	37686397	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	30892832		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26578390, 27380024, 30898507		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	26452132		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27796758		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	25853899	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26314621, 30711014, 32468016	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27796758		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36761165, 37545517	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17911415, 23007163		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19912253, 24799764, 26314621, 36104364	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	29906417	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	31980721	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	24931170		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11857488, 18755890, 18922890, 22234835, 22705304, 22876288, 23227519, 23384942, 23793934, 24931170, 25532106, 28109133, 28181130, 28546132, 28571043, 29133945, 29614984, 29941867, 30884120, 31245927, 31298380, 31347176		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18755890, 23227519, 25726929, 27566954, 28181130, 31298380, 31789396, 32175684, 34036857, 37171615, 37507347	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25532106	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26487287, 35844799	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24339204	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26831666, 27391479, 32390601, 32910747, 33336733, 35321724, 35452485, 39689603	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20978205, 23135998, 23277327, 26542803, 28325285, 31780284		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24816687	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26393886	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27380024	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25909813, 32166404, 34149719	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	26108539	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24816687, 25862909, 26393886, 28216373, 30987661		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29137351		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30538177, 31660818		★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	22574131	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29123965, 30619281		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31780284		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23208495, 26648422		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23208495, 24185687, 25503932, 27126129, 27919977, 28435295, 28929494, 29549306, 30226533, 30909065, 31029422		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27126129, 28174233, 28929494, 34054869	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26160134		★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	25944465		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23793934, 25909813, 29968912, 31451484, 31522588		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30925324		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	LHGDN	18821690		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	23007163		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	23007163	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23223022, 31501273		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23223022, 31501273		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34381015	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35993048	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19912253, 29236750	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36010613	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27583982		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24789908, 28646700		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30058674, 31702490, 31702491		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36965898	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29234882		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29234882	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24816687, 26393886, 28216373, 30987661		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30082829, 30207835, 33693959	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	29135097		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	22139078		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	21219233		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19073608, 20931396, 22040413, 22234835, 24603851, 25149532, 29016934, 31715522		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21912681, 24412053, 36082628	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19073608, 20931396, 22040413, 22234835, 24603851, 25149532, 29016934, 31715522		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22120825, 23373996, 23404538, 24412320, 25394492		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35213267	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37142967	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	36104364	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	36104364	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23115635, 27901488		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	26160134		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25532106	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31786325		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	26897165		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	LHGDN	18821690		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20398663, 31494796		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	28627600	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	30290306		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	27583982		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	27583982		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29137351		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30305621		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	26578390		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	30182381		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	29295562	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	30619281	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24120864		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	22761427		★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	22523595	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22234835, 24339204, 24370822, 27391479, 27519414, 27614453, 28239300, 28253710, 28927113, 31522588		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	22965811		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	31821687		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26542803	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17083624, 29058308	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36104364	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16014635, 22562117, 25101889, 28129605		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17601702		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26393886	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28618418	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11337356, 36389667	Associate	★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	30210296		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	22120825, 24603851		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23115635, 27901488		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11857488, 18755890, 18922890, 22234835, 22705304, 22876288, 23227519, 23384942, 23793934, 24931170, 25532106, 28109133, 28181130, 28546132, 28571043, 29133945, 29614984, 29941867, 30884120, 31245927, 31298380, 31347176		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28450156		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20978205, 21712475, 23135998, 23277327, 26542803, 28325285, 31780284		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	22761427		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24816687, 25862909		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25256401, 28450156, 30290304		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20931396, 23900077, 29511594		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22246571, 22614005, 24573489, 26261179, 28608528, 28693382, 29224003, 29467883, 30728051		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27430434		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19073608, 23115635, 23227519, 24014594, 24185687, 24281003, 24294832, 24370822, 24907395, 25434362, 25503932, 25862909, 26460949, 26546742, 27044823, 27338053, 27796758, 28174233, 28253710, 28927113, 28986256, 29158814, 29728583, 30898507, 30909065, 31450858, 31489189		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23208495, 26648422		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22876288		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27448964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	31935372, 35962880	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	21358347	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	26973020		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	29531171		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	31547989		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29531171		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29531171	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29528545		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32948204	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	24145033	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29655674		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28986256		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	26160134		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	35265721	Inhibit	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	18821690	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	18821690	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	18821690	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	23139243		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28496336, 31823440		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32986380	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	36530027	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17056540, 20819078, 20978205, 21156648, 21219233, 21454924, 21712475, 21750649, 22139078, 22234835, 22246571, 22304369, 22623953, 22705304, 22761427, 22876288, 23115635, 23135998, 23208495, 23793934, 24281003, 24294832, 24339204, 24370822, 24412320, 24573489, 24800261, 24907395, 25149532, 25181544, 25434362, 25503932, 25532106, 25855135, 25862909, 25944465, 26108539, 26542803, 26648422, 26708917, 27430434, 27448964, 27519414, 27919977, 28174233, 28181130, 28239300, 28459998, 28546132, 28571043, 28608528, 28618418, 28986256, 29086376, 29133945, 29158814, 29363227, 29467883, 29531171, 29549306, 29564561, 29614984, 30022841, 30182381, 30290304, 30425578, 30884120, 31253728, 31273318, 31406565, 31483230, 31679271, 31694909		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	21156648		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20230785, 25149532		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21750649, 24281003, 25855135, 26135959, 26464649, 27764812, 28229971, 29532994, 30022841, 30053382, 31406565		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24789908		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33468167	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29796618, 30425578, 30816442, 31102265		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31960764	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24816687, 25862909		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22853714, 26393886, 29158814, 34268922	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25256401, 28259961, 28450156, 30290304		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19628698, 28927576, 29714132, 29738845, 29953413, 31185338, 31547989		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	29953413, 39199388	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	30216441	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	30216441		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31582895		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	26067353		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	LHGDN	18821690		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	31821687		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20931396, 23900077, 29511594		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26172296		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32948204	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22686440	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	31780284		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30202956, 31821687		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23793934, 25909813		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16014635, 26805457, 28664612, 30711014, 31257448		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16014635		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	25656957, 25882257		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	25656957		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	Pubtator	32615059	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	LHGDN	12130517		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	12130517	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25880778, 26108539		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26108539	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23516093, 26708917, 28314263, 30207835		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	20819078		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22246571, 22614005, 24573489, 26261179, 28608528, 28693382, 29224003, 29467883		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21293479, 22246571, 26897165, 29135097, 36519208	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	22139078		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	32615059	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23783103, 26487287, 32685551, 34814333	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	27430434		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27430434		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	21553140, 22304369	Associate	★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	39199388	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25726929	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31776835		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28388561, 33000269	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	35941163, 36831297	Associate	★☆☆☆☆ Found in Text Mining only