HPSE (heparanase)

Gene

• Entrez ID: 10855
• Gene name: Heparanase
• Gene symbol: HPSE
• Synonyms (NCBI Gene): HPA, HPA1, HPR1, HPSE1, HSE1
• Chromosome: 4
• Chromosome location: 4q21.23
• Summary: Heparan sulfate proteoglycans are major components of the basement membrane and extracellular matrix. The protein encoded by this gene is an enzyme that cleaves heparan sulfate proteoglycans to permit cell movement through remodeling of the extracellular

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005537	hsa-miR-1258	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR	21266359
MIRT702813	hsa-miR-7153-3p	HITS-CLIP	23313552
MIRT702812	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT702806	hsa-miR-183-5p	HITS-CLIP	23313552
MIRT685087	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT673614	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT702811	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT702810	hsa-miR-6776-5p	HITS-CLIP	23313552
MIRT702809	hsa-miR-542-3p	HITS-CLIP	23313552
MIRT702807	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT702808	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT702806	hsa-miR-183-5p	HITS-CLIP	23313552
MIRT702805	hsa-miR-1262	HITS-CLIP	23313552
MIRT702804	hsa-miR-4701-3p	HITS-CLIP	23313552
MIRT702803	hsa-miR-6736-5p	HITS-CLIP	23313552
MIRT680210	hsa-miR-5571-5p	HITS-CLIP	23313552
MIRT673619	hsa-miR-5697	HITS-CLIP	23313552
MIRT685087	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT685086	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT685085	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT685084	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT685083	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT685082	hsa-miR-1976	HITS-CLIP	23313552
MIRT685081	hsa-miR-1913	HITS-CLIP	23313552
MIRT685080	hsa-miR-324-3p	HITS-CLIP	23313552
MIRT685079	hsa-miR-5699-5p	HITS-CLIP	23313552
MIRT685078	hsa-miR-4758-3p	HITS-CLIP	23313552
MIRT685077	hsa-miR-3189-5p	HITS-CLIP	23313552
MIRT673601	hsa-miR-1297	HITS-CLIP	23313552
MIRT673600	hsa-miR-26a-5p	HITS-CLIP	23313552
MIRT673599	hsa-miR-26b-5p	HITS-CLIP	23313552
MIRT673598	hsa-miR-4465	HITS-CLIP	23313552
MIRT680209	hsa-miR-4279	HITS-CLIP	23313552
MIRT680210	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT673619	hsa-miR-5697	HITS-CLIP	23824327
MIRT673618	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT673617	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT673616	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT673615	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT673614	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT673613	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT673612	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT673611	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT673610	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT673609	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT673608	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT673607	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT673606	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT673604	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT673603	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT673601	hsa-miR-1297	HITS-CLIP	23824327
MIRT673600	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT673599	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT673598	hsa-miR-4465	HITS-CLIP	23824327
MIRT673597	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT673596	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT680209	hsa-miR-4279	HITS-CLIP	23824327
MIRT673595	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT673594	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT673619	hsa-miR-5697	HITS-CLIP	23824327
MIRT673618	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT673617	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT673616	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT673615	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT673614	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT673613	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT673612	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT673611	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT673610	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT673609	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT673608	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT673607	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT673606	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT673605	hsa-miR-4284	HITS-CLIP	23824327
MIRT673604	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT673603	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT673602	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT673601	hsa-miR-1297	HITS-CLIP	23824327
MIRT673600	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT673599	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT673598	hsa-miR-4465	HITS-CLIP	23824327
MIRT673597	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT673596	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT673595	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT673594	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT530358	hsa-miR-3133	PAR-CLIP	22012620
MIRT530357	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT530356	hsa-miR-3681-5p	PAR-CLIP	22012620
MIRT530355	hsa-miR-6849-5p	PAR-CLIP	22012620
MIRT530354	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT530353	hsa-miR-376b-5p	PAR-CLIP	22012620
MIRT530352	hsa-miR-376c-5p	PAR-CLIP	22012620
MIRT530351	hsa-miR-4536-5p	PAR-CLIP	22012620
MIRT530350	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT530349	hsa-miR-3161	PAR-CLIP	22012620
MIRT530348	hsa-miR-1261	PAR-CLIP	22012620
MIRT732777	hsa-miR-219a-2-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33968189
MIRT734843	hsa-miR-1252-5p	qRT-PCR, Flow cytometry	33488100
MIRT702813	hsa-miR-7153-3p	HITS-CLIP	23313552
MIRT702812	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT702806	hsa-miR-183-5p	HITS-CLIP	23313552
MIRT685087	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT673614	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT702811	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT702810	hsa-miR-6776-5p	HITS-CLIP	23313552
MIRT702809	hsa-miR-542-3p	HITS-CLIP	23313552
MIRT702807	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT702808	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT702806	hsa-miR-183-5p	HITS-CLIP	23313552
MIRT702805	hsa-miR-1262	HITS-CLIP	23313552
MIRT702804	hsa-miR-4701-3p	HITS-CLIP	23313552
MIRT702803	hsa-miR-6736-5p	HITS-CLIP	23313552
MIRT680210	hsa-miR-5571-5p	HITS-CLIP	23313552
MIRT673619	hsa-miR-5697	HITS-CLIP	23313552
MIRT685087	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT685086	hsa-miR-4722-3p	HITS-CLIP	23313552
MIRT685085	hsa-miR-6727-3p	HITS-CLIP	23313552
MIRT685084	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT685083	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT685082	hsa-miR-1976	HITS-CLIP	23313552
MIRT685081	hsa-miR-1913	HITS-CLIP	23313552
MIRT685080	hsa-miR-324-3p	HITS-CLIP	23313552
MIRT685079	hsa-miR-5699-5p	HITS-CLIP	23313552
MIRT685078	hsa-miR-4758-3p	HITS-CLIP	23313552
MIRT685077	hsa-miR-3189-5p	HITS-CLIP	23313552
MIRT673601	hsa-miR-1297	HITS-CLIP	23313552
MIRT673600	hsa-miR-26a-5p	HITS-CLIP	23313552
MIRT673599	hsa-miR-26b-5p	HITS-CLIP	23313552
MIRT673598	hsa-miR-4465	HITS-CLIP	23313552
MIRT680209	hsa-miR-4279	HITS-CLIP	23313552
MIRT680210	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT673619	hsa-miR-5697	HITS-CLIP	23824327
MIRT673618	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT673617	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT673616	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT673615	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT673614	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT673613	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT673612	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT673611	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT673610	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT673609	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT673608	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT673607	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT673606	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT673604	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT673603	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT673601	hsa-miR-1297	HITS-CLIP	23824327
MIRT673600	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT673599	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT673598	hsa-miR-4465	HITS-CLIP	23824327
MIRT673597	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT673596	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT680209	hsa-miR-4279	HITS-CLIP	23824327
MIRT673595	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT673594	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT673619	hsa-miR-5697	HITS-CLIP	23824327
MIRT673618	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT673617	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT673616	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT673615	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT673614	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT673613	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT673612	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT673611	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT673610	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT673609	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT673608	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT673607	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT673606	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT673605	hsa-miR-4284	HITS-CLIP	23824327
MIRT673604	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT673603	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT673602	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT673601	hsa-miR-1297	HITS-CLIP	23824327
MIRT673600	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT673599	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT673598	hsa-miR-4465	HITS-CLIP	23824327
MIRT673597	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT673596	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT673595	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT673594	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT530358	hsa-miR-3133	PAR-CLIP	22012620
MIRT530357	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT530356	hsa-miR-3681-5p	PAR-CLIP	22012620
MIRT530355	hsa-miR-6849-5p	PAR-CLIP	22012620
MIRT530354	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT530353	hsa-miR-376b-5p	PAR-CLIP	22012620
MIRT530352	hsa-miR-376c-5p	PAR-CLIP	22012620
MIRT530351	hsa-miR-4536-5p	PAR-CLIP	22012620
MIRT530350	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT530349	hsa-miR-3161	PAR-CLIP	22012620
MIRT530348	hsa-miR-1261	PAR-CLIP	22012620
MIRT1054424	hsa-miR-1224-5p	CLIP-seq
MIRT1054425	hsa-miR-1225-3p	CLIP-seq
MIRT1054426	hsa-miR-1228	CLIP-seq
MIRT1054427	hsa-miR-1233	CLIP-seq
MIRT1054428	hsa-miR-1283	CLIP-seq
MIRT1054429	hsa-miR-141	CLIP-seq
MIRT1054430	hsa-miR-183	CLIP-seq
MIRT1054431	hsa-miR-186	CLIP-seq
MIRT1054432	hsa-miR-200a	CLIP-seq
MIRT1054433	hsa-miR-200b	CLIP-seq
MIRT1054434	hsa-miR-200c	CLIP-seq
MIRT1054435	hsa-miR-24	CLIP-seq
MIRT1054436	hsa-miR-3120-5p	CLIP-seq
MIRT1054437	hsa-miR-3123	CLIP-seq
MIRT1054438	hsa-miR-3148	CLIP-seq
MIRT1054439	hsa-miR-3165	CLIP-seq
MIRT1054440	hsa-miR-3187-3p	CLIP-seq
MIRT1054441	hsa-miR-3197	CLIP-seq
MIRT1054442	hsa-miR-337-5p	CLIP-seq
MIRT1054443	hsa-miR-342-3p	CLIP-seq
MIRT1054444	hsa-miR-3605-5p	CLIP-seq
MIRT1054445	hsa-miR-3613-3p	CLIP-seq
MIRT1054446	hsa-miR-3614-5p	CLIP-seq
MIRT1054447	hsa-miR-3656	CLIP-seq
MIRT1054448	hsa-miR-3664-3p	CLIP-seq
MIRT1054449	hsa-miR-3675-3p	CLIP-seq
MIRT1054450	hsa-miR-3688-3p	CLIP-seq
MIRT1054451	hsa-miR-3915	CLIP-seq
MIRT1054452	hsa-miR-3925-5p	CLIP-seq
MIRT1054453	hsa-miR-3927	CLIP-seq
MIRT1054454	hsa-miR-4282	CLIP-seq
MIRT1054455	hsa-miR-429	CLIP-seq
MIRT1054456	hsa-miR-4435	CLIP-seq
MIRT1054457	hsa-miR-4451	CLIP-seq
MIRT1054458	hsa-miR-4455	CLIP-seq
MIRT1054459	hsa-miR-4459	CLIP-seq
MIRT1054460	hsa-miR-4485	CLIP-seq
MIRT1054461	hsa-miR-4536	CLIP-seq
MIRT1054462	hsa-miR-4641	CLIP-seq
MIRT1054463	hsa-miR-4684-5p	CLIP-seq
MIRT1054464	hsa-miR-4689	CLIP-seq
MIRT1054465	hsa-miR-4701-5p	CLIP-seq
MIRT1054466	hsa-miR-4716-5p	CLIP-seq
MIRT1054467	hsa-miR-4722-5p	CLIP-seq
MIRT1054468	hsa-miR-4731-5p	CLIP-seq
MIRT1054469	hsa-miR-4751	CLIP-seq
MIRT1054470	hsa-miR-4755-3p	CLIP-seq
MIRT1054471	hsa-miR-4774-5p	CLIP-seq
MIRT1054472	hsa-miR-4778-5p	CLIP-seq
MIRT1054473	hsa-miR-4781-3p	CLIP-seq
MIRT1054474	hsa-miR-494	CLIP-seq
MIRT1054475	hsa-miR-510	CLIP-seq
MIRT1054476	hsa-miR-548aa	CLIP-seq
MIRT1054477	hsa-miR-548m	CLIP-seq
MIRT1054478	hsa-miR-548s	CLIP-seq
MIRT1054479	hsa-miR-548v	CLIP-seq
MIRT1054480	hsa-miR-588	CLIP-seq
MIRT1054481	hsa-miR-595	CLIP-seq
MIRT1054482	hsa-miR-609	CLIP-seq
MIRT1054483	hsa-miR-661	CLIP-seq
MIRT1054484	hsa-miR-766	CLIP-seq
MIRT1054485	hsa-miR-873	CLIP-seq
MIRT1054424	hsa-miR-1224-5p	CLIP-seq
MIRT1054426	hsa-miR-1228	CLIP-seq
MIRT1054486	hsa-miR-1229	CLIP-seq
MIRT1054487	hsa-miR-1253	CLIP-seq
MIRT1054488	hsa-miR-1285	CLIP-seq
MIRT1054429	hsa-miR-141	CLIP-seq
MIRT1054430	hsa-miR-183	CLIP-seq
MIRT1054489	hsa-miR-197	CLIP-seq
MIRT1054432	hsa-miR-200a	CLIP-seq
MIRT1054433	hsa-miR-200b	CLIP-seq
MIRT1054434	hsa-miR-200c	CLIP-seq
MIRT1054490	hsa-miR-2117	CLIP-seq
MIRT1054491	hsa-miR-217	CLIP-seq
MIRT1054435	hsa-miR-24	CLIP-seq
MIRT1054492	hsa-miR-25	CLIP-seq
MIRT1054439	hsa-miR-3165	CLIP-seq
MIRT1054493	hsa-miR-3170	CLIP-seq
MIRT1054440	hsa-miR-3187-3p	CLIP-seq
MIRT1054494	hsa-miR-3187-5p	CLIP-seq
MIRT1054495	hsa-miR-32	CLIP-seq
MIRT1054442	hsa-miR-337-5p	CLIP-seq
MIRT1054443	hsa-miR-342-3p	CLIP-seq
MIRT1054446	hsa-miR-3614-5p	CLIP-seq
MIRT1054496	hsa-miR-363	CLIP-seq
MIRT1054497	hsa-miR-367	CLIP-seq
MIRT1054451	hsa-miR-3915	CLIP-seq
MIRT1054498	hsa-miR-4273	CLIP-seq
MIRT1054455	hsa-miR-429	CLIP-seq
MIRT1054499	hsa-miR-4418	CLIP-seq
MIRT1054500	hsa-miR-4433	CLIP-seq
MIRT1054456	hsa-miR-4435	CLIP-seq
MIRT1054458	hsa-miR-4455	CLIP-seq
MIRT1054460	hsa-miR-4485	CLIP-seq
MIRT1054501	hsa-miR-4677-3p	CLIP-seq
MIRT1054464	hsa-miR-4689	CLIP-seq
MIRT1054465	hsa-miR-4701-5p	CLIP-seq
MIRT1054466	hsa-miR-4716-5p	CLIP-seq
MIRT1054468	hsa-miR-4731-5p	CLIP-seq
MIRT1054469	hsa-miR-4751	CLIP-seq
MIRT1054470	hsa-miR-4755-3p	CLIP-seq
MIRT1054502	hsa-miR-4766-5p	CLIP-seq
MIRT1054471	hsa-miR-4774-5p	CLIP-seq
MIRT1054473	hsa-miR-4781-3p	CLIP-seq
MIRT1054503	hsa-miR-4793-3p	CLIP-seq
MIRT1054504	hsa-miR-509-3-5p	CLIP-seq
MIRT1054505	hsa-miR-509-5p	CLIP-seq
MIRT1054506	hsa-miR-5096	CLIP-seq
MIRT1054478	hsa-miR-548s	CLIP-seq
MIRT1054480	hsa-miR-588	CLIP-seq
MIRT1054481	hsa-miR-595	CLIP-seq
MIRT1054482	hsa-miR-609	CLIP-seq
MIRT1054507	hsa-miR-612	CLIP-seq
MIRT1054483	hsa-miR-661	CLIP-seq
MIRT1054484	hsa-miR-766	CLIP-seq
MIRT1054508	hsa-miR-767-5p	CLIP-seq
MIRT1054509	hsa-miR-92a	CLIP-seq
MIRT1054510	hsa-miR-92b	CLIP-seq
MIRT2012352	hsa-miR-103a	CLIP-seq
MIRT2012353	hsa-miR-107	CLIP-seq
MIRT2012354	hsa-miR-122	CLIP-seq
MIRT1054426	hsa-miR-1228	CLIP-seq
MIRT2012355	hsa-miR-1301	CLIP-seq
MIRT2012356	hsa-miR-1307	CLIP-seq
MIRT2012357	hsa-miR-1343	CLIP-seq
MIRT2012358	hsa-miR-150	CLIP-seq
MIRT2012359	hsa-miR-1827	CLIP-seq
MIRT2012360	hsa-miR-184	CLIP-seq
MIRT1054431	hsa-miR-186	CLIP-seq
MIRT1054433	hsa-miR-200b	CLIP-seq
MIRT1054434	hsa-miR-200c	CLIP-seq
MIRT2012361	hsa-miR-216b	CLIP-seq
MIRT1054491	hsa-miR-217	CLIP-seq
MIRT2012362	hsa-miR-26a	CLIP-seq
MIRT2012363	hsa-miR-26b	CLIP-seq
MIRT2012364	hsa-miR-2964a-3p	CLIP-seq
MIRT2012365	hsa-miR-302f	CLIP-seq
MIRT2012366	hsa-miR-3135b	CLIP-seq
MIRT2012367	hsa-miR-3157-5p	CLIP-seq
MIRT1054440	hsa-miR-3187-3p	CLIP-seq
MIRT1054442	hsa-miR-337-5p	CLIP-seq
MIRT2012368	hsa-miR-3652	CLIP-seq
MIRT1054448	hsa-miR-3664-3p	CLIP-seq
MIRT1054455	hsa-miR-429	CLIP-seq
MIRT1054499	hsa-miR-4418	CLIP-seq
MIRT2012369	hsa-miR-4430	CLIP-seq
MIRT1054456	hsa-miR-4435	CLIP-seq
MIRT1054460	hsa-miR-4485	CLIP-seq
MIRT2012370	hsa-miR-450b-5p	CLIP-seq
MIRT2012371	hsa-miR-4649-3p	CLIP-seq
MIRT2012372	hsa-miR-4691-3p	CLIP-seq
MIRT1054465	hsa-miR-4701-5p	CLIP-seq
MIRT2012373	hsa-miR-4718	CLIP-seq
MIRT1054467	hsa-miR-4722-5p	CLIP-seq
MIRT2012374	hsa-miR-4768-3p	CLIP-seq
MIRT1054473	hsa-miR-4781-3p	CLIP-seq
MIRT2012375	hsa-miR-4804-5p	CLIP-seq
MIRT2012376	hsa-miR-5047	CLIP-seq
MIRT2012377	hsa-miR-507	CLIP-seq
MIRT1054504	hsa-miR-509-3-5p	CLIP-seq
MIRT1054505	hsa-miR-509-5p	CLIP-seq
MIRT1054475	hsa-miR-510	CLIP-seq
MIRT2012378	hsa-miR-512-5p	CLIP-seq
MIRT1054478	hsa-miR-548s	CLIP-seq
MIRT2012379	hsa-miR-557	CLIP-seq
MIRT1054480	hsa-miR-588	CLIP-seq
MIRT2012380	hsa-miR-652	CLIP-seq
MIRT1054485	hsa-miR-873	CLIP-seq
MIRT2012381	hsa-miR-890	CLIP-seq
MIRT2012382	hsa-miR-891b	CLIP-seq
MIRT2012383	hsa-miR-940	CLIP-seq
MIRT2244680	hsa-miR-106a	CLIP-seq
MIRT2244681	hsa-miR-106b	CLIP-seq
MIRT2244682	hsa-miR-1234	CLIP-seq
MIRT2012357	hsa-miR-1343	CLIP-seq
MIRT2012358	hsa-miR-150	CLIP-seq
MIRT2244683	hsa-miR-17	CLIP-seq
MIRT1054430	hsa-miR-183	CLIP-seq
MIRT1054489	hsa-miR-197	CLIP-seq
MIRT2244684	hsa-miR-20a	CLIP-seq
MIRT2244685	hsa-miR-20b	CLIP-seq
MIRT2012362	hsa-miR-26a	CLIP-seq
MIRT2012363	hsa-miR-26b	CLIP-seq
MIRT2244686	hsa-miR-302a	CLIP-seq
MIRT2244687	hsa-miR-302b	CLIP-seq
MIRT2244688	hsa-miR-302c	CLIP-seq
MIRT2244689	hsa-miR-302d	CLIP-seq
MIRT2244690	hsa-miR-302e	CLIP-seq
MIRT2244691	hsa-miR-3159	CLIP-seq
MIRT2244692	hsa-miR-3622b-5p	CLIP-seq
MIRT2244693	hsa-miR-3689a-3p	CLIP-seq
MIRT2244694	hsa-miR-3689c	CLIP-seq
MIRT2244695	hsa-miR-372	CLIP-seq
MIRT2244696	hsa-miR-373	CLIP-seq
MIRT1054500	hsa-miR-4433	CLIP-seq
MIRT2244697	hsa-miR-4728-5p	CLIP-seq
MIRT2244698	hsa-miR-519d	CLIP-seq
MIRT2244699	hsa-miR-520a-3p	CLIP-seq
MIRT2244700	hsa-miR-520b	CLIP-seq
MIRT2244701	hsa-miR-520c-3p	CLIP-seq
MIRT2244702	hsa-miR-520d-3p	CLIP-seq
MIRT2244703	hsa-miR-520e	CLIP-seq
MIRT2244704	hsa-miR-520g	CLIP-seq
MIRT2244705	hsa-miR-520h	CLIP-seq
MIRT1054483	hsa-miR-661	CLIP-seq
MIRT1054484	hsa-miR-766	CLIP-seq
MIRT1054508	hsa-miR-767-5p	CLIP-seq
MIRT2012381	hsa-miR-890	CLIP-seq
MIRT2244706	hsa-miR-93	CLIP-seq
MIRT2547625	hsa-miR-10a	CLIP-seq
MIRT2547626	hsa-miR-10b	CLIP-seq
MIRT2012354	hsa-miR-122	CLIP-seq
MIRT1054426	hsa-miR-1228	CLIP-seq
MIRT1054428	hsa-miR-1283	CLIP-seq
MIRT2012356	hsa-miR-1307	CLIP-seq
MIRT2012357	hsa-miR-1343	CLIP-seq
MIRT2012362	hsa-miR-26a	CLIP-seq
MIRT2012363	hsa-miR-26b	CLIP-seq
MIRT1054436	hsa-miR-3120-5p	CLIP-seq
MIRT2012366	hsa-miR-3135b	CLIP-seq
MIRT1054439	hsa-miR-3165	CLIP-seq
MIRT1054441	hsa-miR-3197	CLIP-seq
MIRT2547627	hsa-miR-339-5p	CLIP-seq
MIRT1054445	hsa-miR-3613-3p	CLIP-seq
MIRT2012368	hsa-miR-3652	CLIP-seq
MIRT1054447	hsa-miR-3656	CLIP-seq
MIRT1054449	hsa-miR-3675-3p	CLIP-seq
MIRT2547628	hsa-miR-371-5p	CLIP-seq
MIRT2547629	hsa-miR-371b-5p	CLIP-seq
MIRT2547630	hsa-miR-3929	CLIP-seq
MIRT1054454	hsa-miR-4282	CLIP-seq
MIRT2547631	hsa-miR-4419b	CLIP-seq
MIRT2547632	hsa-miR-4421	CLIP-seq
MIRT2012369	hsa-miR-4430	CLIP-seq
MIRT2547633	hsa-miR-4478	CLIP-seq
MIRT2012371	hsa-miR-4649-3p	CLIP-seq
MIRT1054463	hsa-miR-4684-5p	CLIP-seq
MIRT2547634	hsa-miR-4698	CLIP-seq
MIRT1054472	hsa-miR-4778-5p	CLIP-seq
MIRT2547635	hsa-miR-485-5p	CLIP-seq
MIRT2547636	hsa-miR-548c-3p	CLIP-seq
MIRT2547625	hsa-miR-10a	CLIP-seq
MIRT2547626	hsa-miR-10b	CLIP-seq
MIRT2012354	hsa-miR-122	CLIP-seq
MIRT1054426	hsa-miR-1228	CLIP-seq
MIRT1054428	hsa-miR-1283	CLIP-seq
MIRT2012356	hsa-miR-1307	CLIP-seq
MIRT1054436	hsa-miR-3120-5p	CLIP-seq
MIRT2012366	hsa-miR-3135b	CLIP-seq
MIRT1054439	hsa-miR-3165	CLIP-seq
MIRT1054441	hsa-miR-3197	CLIP-seq
MIRT2547627	hsa-miR-339-5p	CLIP-seq
MIRT1054445	hsa-miR-3613-3p	CLIP-seq
MIRT2012368	hsa-miR-3652	CLIP-seq
MIRT1054447	hsa-miR-3656	CLIP-seq
MIRT1054449	hsa-miR-3675-3p	CLIP-seq
MIRT2547628	hsa-miR-371-5p	CLIP-seq
MIRT2547629	hsa-miR-371b-5p	CLIP-seq
MIRT2547630	hsa-miR-3929	CLIP-seq
MIRT1054454	hsa-miR-4282	CLIP-seq
MIRT2547631	hsa-miR-4419b	CLIP-seq
MIRT2547632	hsa-miR-4421	CLIP-seq
MIRT2012369	hsa-miR-4430	CLIP-seq
MIRT2547633	hsa-miR-4478	CLIP-seq
MIRT2012371	hsa-miR-4649-3p	CLIP-seq
MIRT1054463	hsa-miR-4684-5p	CLIP-seq
MIRT2547634	hsa-miR-4698	CLIP-seq
MIRT1054472	hsa-miR-4778-5p	CLIP-seq
MIRT2547635	hsa-miR-485-5p	CLIP-seq
MIRT2547636	hsa-miR-548c-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EGR1	Activation	15709168;16007175
EGR1	Unknown	17656651;20403028
NFKB1	Activation	14558943;17715045
POU4F1	Unknown	16112651
RELA	Activation	14558943;17715045

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004566	Function	Beta-glucuronidase activity	TAS	10395325
GO:0005515	Function	Protein binding	IPI	12927802, 15292202, 20561914, 20634491
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IDA	20309870
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005764	Component	Lysosome	IDA	15126626
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0006029	Process	Proteoglycan metabolic process	TAS	10446189
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IDA	12773484
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IDA	16452201
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0030194	Process	Positive regulation of blood coagulation	IDA	20634491
GO:0030200	Process	Heparan sulfate proteoglycan catabolic process	IDA	12213822
GO:0030200	Process	Heparan sulfate proteoglycan catabolic process	IEA
GO:0030202	Process	Heparin proteoglycan metabolic process	IEA
GO:0030305	Function	Heparanase activity	IDA	12927802
GO:0030305	Function	Heparanase activity	IDA	12213822
GO:0030305	Function	Heparanase activity	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0033690	Process	Positive regulation of osteoblast proliferation	IDA	20309870
GO:0033690	Process	Positive regulation of osteoblast proliferation	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0042060	Process	Wound healing	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045121	Component	Membrane raft	IEA
GO:0045545	Function	Syndecan binding	IDA	15292202
GO:0046677	Process	Response to antibiotic	IEA
GO:0051797	Process	Regulation of hair follicle development	IDA	18557927
GO:0051798	Process	Positive regulation of hair follicle development	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	15044433
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0060055	Process	Angiogenesis involved in wound healing	IBA
GO:0060055	Process	Angiogenesis involved in wound healing	IEA
GO:0061028	Process	Establishment of endothelial barrier	IEA
GO:0061042	Process	Vascular wound healing	IEA
GO:0071806	Process	Protein transmembrane transport	IEA
GO:1904974	Component	Heparanase complex	IDA	12927802

Other IDs

• MIM: 604724
• HGNC: 5164
• e!Ensembl: ENSG00000173083

Protein

• UniProt ID: Q9Y251
• Protein name: Heparanase (EC 3.2.1.166) (Endo-glucoronidase) (Heparanase-1) (Hpa1) [Cleaved into: Heparanase 8 kDa subunit; Heparanase 50 kDa subunit]
• Protein function: Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuron
• PDB: 5E8M, 5E97, 5E98, 5E9B, 5E9C, 5L9Y, 5L9Z, 5LA4, 5LA7, 6ZDM, 7PR7, 7PR8, 7PRT, 7RG8, 7YI7, 7YJC, 8B0B, 8B0C, 8BAC, 8CQI, 8E07, 8E08, 8JYG, 8OHQ, 8OHR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03662	Glyco_hydro_79n	146 → 370	Glycosyl hydrolase family 79, N-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in placenta and spleen and weakly expressed in lymph node, thymus, peripheral blood leukocytes, bone marrow, endothelial cells, fetal liver and tumor tissues. Also expressed in hair follicles, specifically in both Henl
• Sequence:

  MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVT
  IDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQS
  QVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCS
  GLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNEPNSFLKKADIFINGS
  QLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYL
  NGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFA
  AGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLM
  ASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQVDKYLL
  RPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVA
  ACI

• Sequence length: 543

Pathways

KEGG:

Glycosaminoglycan degradation
Metabolic pathways
Proteoglycans in cancer

Reactome:

HS-GAG degradation
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE EPISODE, UNSPECIFIED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HPSE-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	28128060		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	20634491		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17611567		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28386074		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11295076, 11992801, 17121850, 18704599		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	12918105		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11759110, 23649655		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11953884, 11992801		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	12443714		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17611567		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	22267022		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	16077909, 16826429, 17550129		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	19835469		★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	12012640, 12071877, 9684730		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	15878761		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	20339231	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	14522383, 18704599		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	19835469		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	26961360, 30239062		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	6248872		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	34107171	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30149270		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30149270		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	12509917		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracoabdominal	Aortic Aneurysm	BEFREE	28659919		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21483695, 23137827, 23499530, 28128060, 29226146, 30075439		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18512775	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	19835469		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18032524	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21483695, 23137827, 23499530, 28128060, 29226146, 30075439		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10395325, 11530216, 20075159, 20840586		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	17041566	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	19749739	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	20653782		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	17850439		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	11351242		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15709168		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18180755		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11547059, 23065570		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16007175		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	25030319, 27067977, 31398734		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	27322195	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet-type bleeding disorder	BEFREE	18067652		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	24954766		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	36980254	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	32118374	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15796387, 28716813		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	12377985, 16093249		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14695198, 15034597, 15316057, 16271435, 16391819, 17457040, 17603633, 17634531, 19602586, 23415719, 24083474, 24632672, 26084486, 27804885, 28038446, 28388549, 28560389, 29417941, 29464068, 30061204, 30543095, 31481501, 31566192		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16391819		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17603633, 19108738, 19602586, 22513363, 23430739, 24083474, 24632672, 28038446, 30922347, 31566192, 33053017, 36139419, 39506780	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	19671168, 26488476, 26972718	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10395325, 10909416, 11351242, 11676857, 12065771, 15040016, 18212251, 20859999, 27804885, 27912844, 28351285		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	27828631	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15334672, 15761980, 22952874, 23771368, 25149140, 25185798, 26839882	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	19955948	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11547059, 23065570		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11759110, 22471483, 22488243, 23649655, 29721203		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22133010, 23251556	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27828631	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	27828631		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11351242, 14612974, 17419711, 23982701, 25586097, 31218100		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28314760		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	18032524, 19368146	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18067652		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	23137827, 23499530, 25966234		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	29803826, 37820587	Associate	★☆☆☆☆ Found in Text Mining only
Cartilaginous exostosis	Osteochondroma	BEFREE	31611818		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	18383324, 32118374	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18057877, 18383324, 18836720, 28778449, 9227689		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	11279932		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19955948, 28337373, 28521428, 30066843		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19955948, 28337373, 28521428, 30066843		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	31538834	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	17611567		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	22267022		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	16077909, 16826429, 17550129		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	19835469		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23704979		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23704979	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	17688924, 21383853, 24235832, 25503134		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	19368146		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	19401035		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17041566	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11021821, 15625607, 15944760, 16093249, 23313782, 27466508, 28147305, 28386173, 30314340		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11021821, 12918105	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15334632, 20193112, 31001480		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11021821, 20193112	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	20193112		★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	15737842		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	28038446	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22133010, 23251556		★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	29379222	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10780317, 15227729, 19515580, 31480068		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10780317, 15227729, 15741796, 19515580, 28086795, 31480068, 9684730		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28086795	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10583927, 10780317, 15227729, 19515580, 31480068		★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	11529861		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	17041566	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23511033		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18512775, 28877607, 29803826		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18512775		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	18191725		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	18180755		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	24169805		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17051139, 24333941, 27999107, 28128060, 28163306, 28314760, 28919014, 30902310, 31480068		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	21364956	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17051139, 24333941, 27999107, 28128060, 28163306, 28314760, 28743882, 28919014, 30902310, 31480068, 9684730		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28038446	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21364956	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22187315, 23499527, 29415062		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21364956, 22187315, 25966234		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	28810553		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	21600934, 23095131	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15983219, 21600934, 22106160, 23095131, 24937189, 28478303, 28743882, 28994624		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15983219, 17051139		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26720478		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	19715595		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12904690		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12904690		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16803537, 19003663, 32869952	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	14989983, 17141400		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	17481627, 18674655		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18674655	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	11351242, 14612974		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11295076, 11691803, 15286661, 16097072, 16299228		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11295076, 11691803, 15286661, 16097072, 16299228		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	11676857, 15286661, 15810091, 16097072, 19749739	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	16097072		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	11676857	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16097072, 35840985	Inhibit	★☆☆☆☆ Found in Text Mining only
Exostoses Multiple Hereditary	Exostoses	Pubtator	18452536	Associate	★☆☆☆☆ Found in Text Mining only
Familial cold urticaria	Cold urticaria	BEFREE	22227299		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30075439		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	17699790		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29097791		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	27091112		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	14676122		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28351285, 29598788		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	25351637	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29396688		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15796387, 22001963, 24045042, 29104277		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32075104, 37508554	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15796387, 19835469, 22001963, 24045042, 29104277		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	14633698, 15034597, 15796387, 18647407, 19835469, 28778449, 31032901		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	14633698		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18647407, 29104277	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	27091112		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	20075159, 34685503, 34848216, 34943994	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	20075159, 20840586, 29955035		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	17217623, 18798279, 19074873, 22194600, 24286246		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	19074873		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	19074873, 24286246	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	31004678		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	17611567, 27912844		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	19749739, 34943994	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	20576607	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Fever with Renal Syndrome	Hemorrhagic fever with renal syndrome	Pubtator	35336857	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	25335953, 34848216	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	25335953		★☆☆☆☆ Found in Text Mining only
Hepatoerythropoietic Porphyria	Hepatoerythropoietic Porphyria	BEFREE	15368349, 15799825		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	21131364, 25727320		★☆☆☆☆ Found in Text Mining only
Hereditary Multiple Exostoses	Multiple congenital exostosis	BEFREE	18452536, 25863260, 31611818		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	17611567		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25463481, 30902310		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	BEFREE	2892779		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19368146	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19368146		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31327483	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	24887057		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	27091112		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	25133636		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	10545851, 28823219, 8157033		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	17536013		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	23907942	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17041566	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23499528		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	24169805		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	21789398	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	23370684		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	21789398	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Thrombosis	Intracranial thrombosis	Pubtator	32118374	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	22575501		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	21266359		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28004990, 28720149		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	29379222		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	29379222	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	17850439		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27804885, 28163306		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	19368146	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28388547, 28970256, 30546836		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	19368146		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	17401459		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11823035		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11823035	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11823035	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11823035, 17611567		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	11167146, 20859999		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10395325, 10909416, 12407728, 15112962, 15334672, 15761980, 17467664, 22267022, 22472882, 22952874, 23308126, 23771368, 24153013, 24530413, 25149140, 25185798, 26132704, 26600502, 28209511, 28442387, 28981558, 29158804, 29728874, 31271612, 7499786, 7621443		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15334672, 18773863		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10395325, 10909416, 25185798, 26132704, 28442387		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	15334672	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	11759110, 18618498		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11759110, 18618498, 22471483, 23649655	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22064654		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27091112		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15040016, 15286661, 15475937, 20193112, 20339231, 24766948, 25343173, 30386106	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	15475937, 22133010, 28209511		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15810091, 16803537, 22133010, 26569485	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	11823035		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10395325, 10909416, 15316057, 27912844, 30096360		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	18180755		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	17217623, 22194600, 24286246		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15672872, 19935710		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14695198, 16271435, 16391819, 17457040, 17603633, 17634531, 19602586, 23415719, 24083474, 24632672, 26084486, 27804885, 28388549, 28560389, 29417941, 30061204, 30543095, 31481501, 31566192		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16391819		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	12904690		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11295076, 11691803, 15286661, 16097072, 16299228		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	11295076, 15944760		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22267022, 30314340		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11759110, 22488243, 23649655, 29721203		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	11167146, 20859999		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11351242, 17419711, 23982701, 25586097, 31218100		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11992801, 18704599, 28938567, 29153700		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14522383, 15709168, 18487013, 22363633, 25494645		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11848495, 12065771, 12746471, 15040016, 15844185, 20137078, 20403028, 20578081, 22276173, 25727320, 26689987, 26745132, 27685626, 28521475, 29434786, 30320396, 30386106, 31257534		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	14676122		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	19031943		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11547059, 23065570		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10395325, 10909416, 11167146, 11295076, 11547059, 11676857, 11953884, 11992801, 12824922, 14612974, 14676122, 14695190, 15034597, 15100677, 15286661, 15316057, 15672872, 15760902, 15944760, 16204381, 16299228, 16901744, 17121850, 17208203, 17217623, 17339837, 17457040, 17611567, 17952066, 18212251, 18425416, 18487013, 19029817, 19093259, 19242059, 19955948, 20137078, 20164500, 20578081, 20619346, 20653782, 21376137, 21505696, 21532885, 22267022, 22276173, 22488243, 22893710, 22956610, 23352437, 23374281, 23398975, 23499528, 23499530, 23644656, 23794232, 23982701, 24083474, 24286246, 24632672, 24954766, 24970482, 25343173, 26120938, 27016342, 27067977, 27166252, 27576132, 27595937, 27758044, 27912844, 28025251, 28075546, 28359266, 28386074, 28560389, 28710312, 28981558, 29025661, 29153700, 29162390, 29417941, 29511351, 29579286, 29671088, 29955035, 30096360, 30333909, 30818840, 30905465, 31044520, 31110966, 31398734, 31812535, 31850210		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19955948, 28337373, 28521428, 30066843		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11021821, 15625607, 15944760, 28147305, 28386173, 30314340		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16391819		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	19360105		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12219030, 16217746		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16391819		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28038446, 31481501		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16391819		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	16077909, 16826429, 17550129		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	16826429		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10395325, 10909416, 15368349, 15799825, 21624769, 22719918, 23847439, 25343173, 25745999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	15368349, 15645118, 16288472, 16867222, 18288398		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	16867222, 18288398, 20803552, 25343173, 27732945, 31044520	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	22240343		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	22187315, 27091112		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29579286, 30627323		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28038446		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	28038446	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	15368349, 15796387, 27732945		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	11279932		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	23907942		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	20859999, 24766948, 25295847	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	11351242		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	Pubtator	22276173	Associate	★☆☆☆☆ Found in Text Mining only
mucosal melanoma	Mucosal Melanoma	BEFREE	23794232		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	14695190, 15471949, 17536013, 17611567, 20978204, 21131364, 24699306, 24954766, 25944690, 26624982, 26849235, 27016342, 27912844, 31812535		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15471949, 17339423, 18812315, 20097882, 23048032, 23430739, 26762172, 27016342, 32899927, 36980254	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28778449		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	17611567		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17611567, 26489695		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	26489695		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10780317, 15227729, 22752805, 9359557, 9569182		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	15227729	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19401035		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23467769		★☆☆☆☆ Found in Text Mining only
Neonatal Alloimmune Thrombocytopenia	Alloimmune Thrombocytopenia	BEFREE	12012640, 16178861, 19500319, 7516786, 8140066		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10455023, 10909416, 11021821, 11123890, 11351242, 11530216, 11953884, 11992801, 12407728, 14522383, 14612974, 14633698, 14676122, 14695190, 15040016, 15334632, 15471949, 15475937, 15625607, 15672872, 15761980, 15837740, 15878761, 15944760, 16041398, 16093249, 16097072, 16299228, 16388520, 16391819, 16452201, 16901744, 17062704, 17217623, 17339837, 17347152, 17401459, 17536013, 17627539, 17850439, 17952066, 18023704, 18212251, 18425416, 18798279, 19242059, 19661141, 19955948, 20164500, 20978204, 21131364, 21383853, 21505696, 21532885, 22009724, 22083213, 22194600, 22363633, 22575501, 22952874, 23251556, 23308126, 23313782, 23374281, 23467769, 23644656, 23794232, 23982701, 24235832, 24632672, 24887057, 24970482, 25343173, 25616966, 25727320, 25849134, 26132704, 26168818, 26230211, 26624982, 26745132, 26849235, 27016342, 27067977, 27166252, 27576132, 27732945, 27912844, 28038446, 28147305, 28163306, 28385219, 28388549, 28581441, 28778876, 28850787, 28888912, 28916201, 29025661, 29162390, 29225052, 29464068, 29579286, 29671088, 29721203, 30333909, 30412404, 30441818, 30627323, 30818840, 30819081, 31001480, 31032901, 31128083, 31348993, 31481501, 31566192, 31664180, 31682909, 31690669, 31812535		★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	CTD_human_DG	16899518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	15144715, 15610235		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	15610235		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	15610235	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25616966, 27595937, 3998711		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28778449		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	23644656, 26230211		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30573200		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19661141, 22488243		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19096032, 31481501		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36139419	Associate	★☆☆☆☆ Found in Text Mining only
Ochoa syndrome	Ochoa Syndrome	BEFREE	25145936, 26315301, 30885509		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17634531		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	19835469		★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	32899927	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	20309870	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	20978204, 27389089		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20845995		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	17419711		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11351242, 14612974, 17419711, 23982701, 25586097, 31218100		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17419711		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17419711, 17437011, 35299895	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	19071009		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11953884, 11992801, 16388520, 18704599, 28938567, 29153700		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18704599		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11953884	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16388520	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	14676122		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24189015	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31611818		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29581478		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	12443714		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	26720478		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	26720478		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14522383, 15709168, 18212251, 18487013, 22363633, 25494645		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18212251		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18487013		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22363633	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	15610235, 35336857	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24169805		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18809970		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23251556		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	22102278, 24937189		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	18046314, 28163306		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28659919		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27498004		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	22820644		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	22956610		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	27418016, 30383717		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	22773903		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	19715595		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	19715595	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	19715595	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18512775, 23499528, 28401953		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18512775		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	17032504	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	26569485	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24887057		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	24887057, 31566192	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	28387673		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27067977, 28170292, 28659919, 29120525, 29616016, 30654825		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	LHGDN	12824922		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	6162380		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29087043		★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	25335953		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11295076, 11676857, 12824922, 15034597, 15286661, 27828631		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12679316, 12824922, 16097072, 17217623		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12679316, 16097072		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17217623, 24286246, 24766948, 37481997	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15837740, 17217623, 24286246		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	31215255		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	23162016		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30075439, 30573200		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	24887057		★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	15610235		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11848495, 12065771, 12746471, 15040016, 15475937, 15844185, 19469644, 20137078, 20403028, 20578081, 20653782, 22276173, 25727320, 26689987, 26745132, 27685626, 28521475, 29434786, 30320396, 30386106, 31257534		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12065771, 15682491		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	12746471, 20578081		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15040016, 15475937, 15682491, 18609704, 19469644, 19916174, 20137078, 22276173, 22363633, 25337202, 27685626, 30386106, 31257534	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17717429	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	32118374	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28720149		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	6162380		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	29225052, 6162380		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	27890389		★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	19245802, 7655575, 8251377		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	26489695, 27067977		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia Neonatal Alloimmune	Thrombocytopenia	Pubtator	11370330, 16178861, 23155369, 23865077	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	30383717		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	23155369	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	14676122		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14676122		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	11779847, 26488476	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	17955520	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31252265		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	39506780	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	18180755		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18283334	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22363633, 23065570, 28794202	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	14504050, 19955948, 24286246, 27166252	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	17481627	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10764835		★☆☆☆☆ Found in Text Mining only
Vasculopathy Retinal With Cerebral Leukodystrophy	Retinal vasculopathy with cerebral leukodystrophy	Pubtator	34848216	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	31538834	Associate	★☆☆☆☆ Found in Text Mining only
von Willebrand Disease, Type 1	von Willebrand disorder	BEFREE	14652648		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	19835469		★☆☆☆☆ Found in Text Mining only