Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10817
Gene name	Fibroblast growth factor receptor substrate 3
Gene symbol	FRS3
Synonyms (NCBI Gene)	FRS2-betaFRS2BFRS2betaSNT-2SNT2
Chromosome	6
Chromosome location	6p21.1
Summary	This gene encodes a substrate for the fibroblast growth factor receptor. The encoded protein is found in the peripheral plasma membrane and links fibroblast growth factor receptor stimulation to activators of Ras. The encoded protein down-regulates extrac

Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030227	hsa-miR-26b-5p	Microarray	19088304
MIRT1997922	hsa-miR-2355-5p	CLIP-seq
MIRT1997923	hsa-miR-4698	CLIP-seq
MIRT1997924	hsa-miR-4768-5p	CLIP-seq
MIRT1997925	hsa-miR-942	CLIP-seq
MIRT2442172	hsa-miR-4768-3p	CLIP-seq
MIRT2442173	hsa-miR-665	CLIP-seq
MIRT2449911	hsa-miR-1254	CLIP-seq
MIRT1997922	hsa-miR-2355-5p	CLIP-seq
MIRT2449912	hsa-miR-3116	CLIP-seq
MIRT2449913	hsa-miR-4254	CLIP-seq
MIRT1997924	hsa-miR-4768-5p	CLIP-seq
MIRT1997925	hsa-miR-942	CLIP-seq
MIRT2442172	hsa-miR-4768-3p	CLIP-seq
MIRT2442173	hsa-miR-665	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	IBA
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005104	Function	Fibroblast growth factor receptor binding	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IPI	9660748
GO:0005515	Function	Protein binding	IPI	18985028, 25416956, 25814554, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	TAS	8761293
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	9660748
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS	8761293
GO:0016020	Component	Membrane	IEA
GO:0042802	Function	Identical protein binding	IPI	25814554, 32296183

MIM	HGNC	e!Ensembl
607744	16970	ENSG00000137218

O43559

Protein name

Fibroblast growth factor receptor substrate 3 (FGFR substrate 3) (FGFR-signaling adaptor SNT2) (Suc1-associated neurotrophic factor target 2) (SNT-2)

Protein function

Adapter protein that links FGF and NGF receptors to downstream signaling pathways. Involved in the activation of MAP kinases. Down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2. {ECO:0000269|P

PDB

2KUP , 2KUQ , 2YS5 , 2YT2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02174	IRS	17 → 109	PTB domain (IRS-1 type)	Domain

Sequence

MGSCCSCLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIIT
RNSHPAELDLPRAPQPPNALGYTVSSFSNGCPGEGPRFSAPRRLSTSSLRHPSLGEESTH
ALIAPDEQSHTYVNTPASEDDHRRGRHCLQPLPEGQAPFLPQARGPDQRDPQVFLQPGQV
KFVLGPTPARRHMVKCQGLCPSLHDPPHHNNNNEAPSECPAQPKCTYENVTGGLWRGAGW
RLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGF
PDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPGPEPPRQLNYIQV
ELKGWGGDRPKGPQNPSSPQAPMPTTHPARSSDSYAVIDLKKTVAMSNLQRALPRDDGTA
RKTRHNSTDLPL

Sequence length

492

Interactions

View interactions

	Reactome
			FRS-mediated FGFR1 signaling FRS-mediated FGFR2 signaling FRS-mediated FGFR3 signaling FRS-mediated FGFR4 signaling RAF/MAP kinase cascade

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	18507837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23279575	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22078327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20228838, 22078327, 23279575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20228838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22078327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22078327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37863651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FRS3 (fibroblast growth factor receptor substrate 3)