SPINT3 (serine peptidase inhibitor, Kunitz type 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 10816
Gene name Serine peptidase inhibitor, Kunitz type 3
Gene symbol SPINT3
Synonyms (NCBI Gene)
HKIB9
Chromosome 20
Chromosome location 20q13.12
miRNA miRNA information provided by mirtarbase database.
217
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (217)
miRTarBase ID miRNA Experiments Reference
MIRT614640 hsa-miR-8485 HITS-CLIP 23824327
MIRT614639 hsa-miR-532-5p HITS-CLIP 23824327
MIRT614638 hsa-miR-105-5p HITS-CLIP 23824327
MIRT614637 hsa-miR-7853-5p HITS-CLIP 23824327
MIRT614636 hsa-miR-4297 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (3)
GO ID Ontology Definition Evidence Reference
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005576 Component Extracellular region IEA
GO:0030414 Function Peptidase inhibitor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613941 11248 ENSG00000101446
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P49223
Protein name Kunitz-type protease inhibitor 3 (HKIB9)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00014 Kunitz_BPTI 35 → 87 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
Sequence 
MQLQASLSFLLILTLCLELRSELARDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGE
CELFAYGGCGGNSNNFLRKEKCEKFCKFT
Sequence length 89
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (2)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BLADDER EXSTROPHY AND EPISPADIAS COMPLEX — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bladder exstrophy-epispadias-cloacal extrophy complex Uncertain significance ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations