Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10814
Gene name	Complexin 2
Gene symbol	CPLX2
Synonyms (NCBI Gene)	921-LCPX-2CPX2Hfb1
Chromosome	5
Chromosome location	5q35.2
Summary	Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and di

179

Show/Hide all (179)

miRTarBase ID	miRNA	Experiments	Reference
MIRT713799	hsa-miR-574-3p	HITS-CLIP	19536157
MIRT713798	hsa-miR-1306-5p	HITS-CLIP	19536157
MIRT713797	hsa-miR-3622a-3p	HITS-CLIP	19536157
MIRT713796	hsa-miR-3622b-3p	HITS-CLIP	19536157
MIRT713795	hsa-miR-6765-3p	HITS-CLIP	19536157
MIRT713799	hsa-miR-574-3p	HITS-CLIP	19536157
MIRT713798	hsa-miR-1306-5p	HITS-CLIP	19536157
MIRT713797	hsa-miR-3622a-3p	HITS-CLIP	19536157
MIRT713796	hsa-miR-3622b-3p	HITS-CLIP	19536157
MIRT713795	hsa-miR-6765-3p	HITS-CLIP	19536157
MIRT906274	hsa-miR-1197	CLIP-seq
MIRT906275	hsa-miR-1200	CLIP-seq
MIRT906276	hsa-miR-1224-3p	CLIP-seq
MIRT906277	hsa-miR-1225-3p	CLIP-seq
MIRT906278	hsa-miR-1237	CLIP-seq
MIRT906279	hsa-miR-1260	CLIP-seq
MIRT906280	hsa-miR-1260b	CLIP-seq
MIRT906281	hsa-miR-1280	CLIP-seq
MIRT906282	hsa-miR-148a	CLIP-seq
MIRT906283	hsa-miR-148b	CLIP-seq
MIRT906284	hsa-miR-152	CLIP-seq
MIRT906285	hsa-miR-1825	CLIP-seq
MIRT906286	hsa-miR-1909	CLIP-seq
MIRT906287	hsa-miR-1912	CLIP-seq
MIRT906288	hsa-miR-194	CLIP-seq
MIRT906289	hsa-miR-1972	CLIP-seq
MIRT906290	hsa-miR-214	CLIP-seq
MIRT906291	hsa-miR-2355-5p	CLIP-seq
MIRT906292	hsa-miR-2467-3p	CLIP-seq
MIRT906293	hsa-miR-296-5p	CLIP-seq
MIRT906294	hsa-miR-3138	CLIP-seq
MIRT906295	hsa-miR-3184	CLIP-seq
MIRT906296	hsa-miR-3192	CLIP-seq
MIRT906297	hsa-miR-3199	CLIP-seq
MIRT906298	hsa-miR-3607-3p	CLIP-seq
MIRT906299	hsa-miR-3616-3p	CLIP-seq
MIRT906300	hsa-miR-3619-5p	CLIP-seq
MIRT906301	hsa-miR-3678-3p	CLIP-seq
MIRT906302	hsa-miR-3686	CLIP-seq
MIRT906303	hsa-miR-3690	CLIP-seq
MIRT906304	hsa-miR-376c	CLIP-seq
MIRT906305	hsa-miR-3909	CLIP-seq
MIRT906306	hsa-miR-423-5p	CLIP-seq
MIRT906307	hsa-miR-4254	CLIP-seq
MIRT906308	hsa-miR-4323	CLIP-seq
MIRT906309	hsa-miR-4324	CLIP-seq
MIRT906310	hsa-miR-4436b-3p	CLIP-seq
MIRT906311	hsa-miR-4477b	CLIP-seq
MIRT906312	hsa-miR-4515	CLIP-seq
MIRT906313	hsa-miR-4520a-3p	CLIP-seq
MIRT906314	hsa-miR-4527	CLIP-seq
MIRT906315	hsa-miR-4650-5p	CLIP-seq
MIRT906316	hsa-miR-4651	CLIP-seq
MIRT906317	hsa-miR-4711-5p	CLIP-seq
MIRT906318	hsa-miR-4713-5p	CLIP-seq
MIRT906319	hsa-miR-4731-3p	CLIP-seq
MIRT906320	hsa-miR-4786-5p	CLIP-seq
MIRT906321	hsa-miR-4789-3p	CLIP-seq
MIRT906322	hsa-miR-4793-5p	CLIP-seq
MIRT906323	hsa-miR-4801	CLIP-seq
MIRT906324	hsa-miR-516a-3p	CLIP-seq
MIRT906325	hsa-miR-532-3p	CLIP-seq
MIRT906326	hsa-miR-541	CLIP-seq
MIRT906327	hsa-miR-544b	CLIP-seq
MIRT906328	hsa-miR-608	CLIP-seq
MIRT906329	hsa-miR-654-5p	CLIP-seq
MIRT906330	hsa-miR-661	CLIP-seq
MIRT906331	hsa-miR-761	CLIP-seq
MIRT906332	hsa-miR-3154	CLIP-seq
MIRT906297	hsa-miR-3199	CLIP-seq
MIRT906333	hsa-miR-342-5p	CLIP-seq
MIRT906334	hsa-miR-4433	CLIP-seq
MIRT906335	hsa-miR-4475	CLIP-seq
MIRT906336	hsa-miR-4481	CLIP-seq
MIRT906312	hsa-miR-4515	CLIP-seq
MIRT906337	hsa-miR-4648	CLIP-seq
MIRT906316	hsa-miR-4651	CLIP-seq
MIRT906338	hsa-miR-4652-5p	CLIP-seq
MIRT906339	hsa-miR-4664-5p	CLIP-seq
MIRT906340	hsa-miR-4745-5p	CLIP-seq
MIRT906341	hsa-miR-542-3p	CLIP-seq
MIRT906328	hsa-miR-608	CLIP-seq
MIRT1968615	hsa-miR-4313	CLIP-seq
MIRT906316	hsa-miR-4651	CLIP-seq
MIRT906328	hsa-miR-608	CLIP-seq
MIRT1968616	hsa-miR-1291	CLIP-seq
MIRT1968617	hsa-miR-1343	CLIP-seq
MIRT1968618	hsa-miR-3127-3p	CLIP-seq
MIRT1968619	hsa-miR-3144-5p	CLIP-seq
MIRT1968620	hsa-miR-3191	CLIP-seq
MIRT906333	hsa-miR-342-5p	CLIP-seq
MIRT1968621	hsa-miR-3652	CLIP-seq
MIRT1968622	hsa-miR-3679-3p	CLIP-seq
MIRT1968623	hsa-miR-4260	CLIP-seq
MIRT1968624	hsa-miR-4283	CLIP-seq
MIRT1968625	hsa-miR-4287	CLIP-seq
MIRT1968626	hsa-miR-4430	CLIP-seq
MIRT1968627	hsa-miR-4446-5p	CLIP-seq
MIRT1968628	hsa-miR-4447	CLIP-seq
MIRT1968629	hsa-miR-4472	CLIP-seq
MIRT1968630	hsa-miR-4489	CLIP-seq
MIRT906338	hsa-miR-4652-5p	CLIP-seq
MIRT906339	hsa-miR-4664-5p	CLIP-seq
MIRT1968631	hsa-miR-4667-5p	CLIP-seq
MIRT1968632	hsa-miR-4685-3p	CLIP-seq
MIRT1968633	hsa-miR-4700-5p	CLIP-seq
MIRT1968634	hsa-miR-593	CLIP-seq
MIRT1968635	hsa-miR-939	CLIP-seq
MIRT2204687	hsa-miR-1	CLIP-seq
MIRT906276	hsa-miR-1224-3p	CLIP-seq
MIRT906279	hsa-miR-1260	CLIP-seq
MIRT906280	hsa-miR-1260b	CLIP-seq
MIRT906281	hsa-miR-1280	CLIP-seq
MIRT2204688	hsa-miR-1915	CLIP-seq
MIRT2204689	hsa-miR-206	CLIP-seq
MIRT2204690	hsa-miR-3064-5p	CLIP-seq
MIRT1968619	hsa-miR-3144-5p	CLIP-seq
MIRT2204691	hsa-miR-3187-3p	CLIP-seq
MIRT1968620	hsa-miR-3191	CLIP-seq
MIRT906297	hsa-miR-3199	CLIP-seq
MIRT2204692	hsa-miR-329	CLIP-seq
MIRT2204693	hsa-miR-331-3p	CLIP-seq
MIRT906333	hsa-miR-342-5p	CLIP-seq
MIRT2204694	hsa-miR-3545-5p	CLIP-seq
MIRT2204695	hsa-miR-362-3p	CLIP-seq
MIRT1968621	hsa-miR-3652	CLIP-seq
MIRT2204696	hsa-miR-3918	CLIP-seq
MIRT2204697	hsa-miR-3941	CLIP-seq
MIRT2204698	hsa-miR-4269	CLIP-seq
MIRT1968626	hsa-miR-4430	CLIP-seq
MIRT906334	hsa-miR-4433	CLIP-seq
MIRT2204699	hsa-miR-4435	CLIP-seq
MIRT2204700	hsa-miR-4446-3p	CLIP-seq
MIRT1968628	hsa-miR-4447	CLIP-seq
MIRT2204701	hsa-miR-4453	CLIP-seq
MIRT1968629	hsa-miR-4472	CLIP-seq
MIRT906336	hsa-miR-4481	CLIP-seq
MIRT2204702	hsa-miR-4488	CLIP-seq
MIRT2204703	hsa-miR-4492	CLIP-seq
MIRT2204704	hsa-miR-4498	CLIP-seq
MIRT2204705	hsa-miR-4505	CLIP-seq
MIRT906312	hsa-miR-4515	CLIP-seq
MIRT2204706	hsa-miR-4538	CLIP-seq
MIRT2204707	hsa-miR-4640-5p	CLIP-seq
MIRT906337	hsa-miR-4648	CLIP-seq
MIRT906316	hsa-miR-4651	CLIP-seq
MIRT906338	hsa-miR-4652-5p	CLIP-seq
MIRT906339	hsa-miR-4664-5p	CLIP-seq
MIRT1968631	hsa-miR-4667-5p	CLIP-seq
MIRT2204708	hsa-miR-4685-5p	CLIP-seq
MIRT2204709	hsa-miR-4697-5p	CLIP-seq
MIRT1968633	hsa-miR-4700-5p	CLIP-seq
MIRT2204710	hsa-miR-4701-5p	CLIP-seq
MIRT2204711	hsa-miR-4726-5p	CLIP-seq
MIRT2204712	hsa-miR-4731-5p	CLIP-seq
MIRT906340	hsa-miR-4745-5p	CLIP-seq
MIRT2204713	hsa-miR-486-3p	CLIP-seq
MIRT906325	hsa-miR-532-3p	CLIP-seq
MIRT906326	hsa-miR-541	CLIP-seq
MIRT906341	hsa-miR-542-3p	CLIP-seq
MIRT2204714	hsa-miR-548s	CLIP-seq
MIRT2204715	hsa-miR-588	CLIP-seq
MIRT2204716	hsa-miR-592	CLIP-seq
MIRT2204717	hsa-miR-597	CLIP-seq
MIRT906328	hsa-miR-608	CLIP-seq
MIRT2204718	hsa-miR-613	CLIP-seq
MIRT2204719	hsa-miR-647	CLIP-seq
MIRT906329	hsa-miR-654-5p	CLIP-seq
MIRT2204720	hsa-miR-762	CLIP-seq
MIRT2204721	hsa-miR-766	CLIP-seq
MIRT906316	hsa-miR-4651	CLIP-seq
MIRT906328	hsa-miR-608	CLIP-seq
MIRT2386403	hsa-miR-3170	CLIP-seq
MIRT2386404	hsa-miR-4326	CLIP-seq
MIRT906314	hsa-miR-4527	CLIP-seq
MIRT2386405	hsa-miR-4691-5p	CLIP-seq
MIRT906317	hsa-miR-4711-5p	CLIP-seq
MIRT2386406	hsa-miR-4719	CLIP-seq
MIRT2386407	hsa-miR-619	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000149	Function	SNARE binding	IBA
GO:0000149	Function	SNARE binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006887	Process	Exocytosis	IEA
GO:0006904	Process	Vesicle docking involved in exocytosis	TAS	7553862
GO:0007399	Process	Nervous system development	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	IBA
GO:0016079	Process	Synaptic vesicle exocytosis	IEA
GO:0017075	Function	Syntaxin-1 binding	IEA
GO:0017157	Process	Regulation of exocytosis	IEA
GO:0017157	Process	Regulation of exocytosis	TAS	15217342
GO:0019905	Function	Syntaxin binding	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031201	Component	SNARE complex	IBA
GO:0031201	Component	SNARE complex	IEA
GO:0031630	Process	Regulation of synaptic vesicle fusion to presynaptic active zone membrane	IBA
GO:0031630	Process	Regulation of synaptic vesicle fusion to presynaptic active zone membrane	IEA
GO:0031915	Process	Positive regulation of synaptic plasticity	IEA
GO:0031915	Process	Positive regulation of synaptic plasticity	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043195	Component	Terminal bouton	IBA
GO:0043204	Component	Perikaryon	IEA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0044305	Component	Calyx of Held	IEA
GO:0045202	Component	Synapse	IEA
GO:0048306	Function	Calcium-dependent protein binding	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA
GO:0070033	Component	Synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex	IEA
GO:0070554	Component	Synaptobrevin 2-SNAP-25-syntaxin-3-complexin complex	IEA
GO:0070554	Component	Synaptobrevin 2-SNAP-25-syntaxin-3-complexin complex	TAS	15217342
GO:0098793	Component	Presynapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
605033	2310	ENSG00000145920

Q6PUV4

Protein name

Complexin-2 (Complexin II) (CPX II) (Synaphin-1)

Protein function

Negatively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. Positively regulates a late step in exocytosis of various cytoplasmic vesicles, such as synaptic vesicles and ot

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05835	Synaphin	1 → 133	Synaphin protein	Family

Tissue specificity

TISSUE SPECIFICITY: Nervous system. In hippocampus and cerebellum, expressed mainly by excitatory neurons. Down-regulated in brain cortex from patients suffering from Huntington disease, bipolar disorder or major depression. Down-regulated in cerebellum f

Sequence

MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE
KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV
LKYLPGPLQDMFKK

Sequence length

134

Interactions

View interactions

	KEGG
	Synaptic vesicle cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	31699905	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	22832958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21832240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	23527680		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	14708030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Diseases	Brain disease	Pubtator	25297695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	25297695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36581948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	25297695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	23912489	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	22832958	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	14708030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	20584925		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	20584925		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	32987560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20584925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25297695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	20584925		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	20584925		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	20584925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychosis, Brief Reactive	Psychosis	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	CTD_human_DG	14708030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11483314, 15653259, 16442780, 20412316, 20819981, 21145444, 25297695, 9853440		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	11483314, 14708030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15653259		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25297695	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophreniform Disorders	Schizophreniform Disorders	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28239029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CPLX2 (complexin 2)