Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10809
Gene name	StAR related lipid transfer domain containing 10
Gene symbol	STARD10
Synonyms (NCBI Gene)	CGI-52NY-CO-28PCTP2SDCCAG28
Chromosome	11
Chromosome location	11q13.4

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003632	hsa-miR-661	immunoblotqRT-PCR	20543867
MIRT731281	hsa-miR-638	ImmunoblotLuciferase reporter assayqRT-PCR	28412359
MIRT731281	hsa-miR-638	ImmunoblotLuciferase reporter assayqRT-PCR	28412359
MIRT731281	hsa-miR-638	ImmunoblotLuciferase reporter assayqRT-PCR	28412359
MIRT731281	hsa-miR-638	ImmunoblotLuciferase reporter assayqRT-PCR	28412359
MIRT1395133	hsa-miR-103a	CLIP-seq
MIRT1395134	hsa-miR-107	CLIP-seq
MIRT1395135	hsa-miR-1184	CLIP-seq
MIRT1395136	hsa-miR-1227	CLIP-seq
MIRT1395137	hsa-miR-1275	CLIP-seq
MIRT1395138	hsa-miR-1538	CLIP-seq
MIRT1395139	hsa-miR-198	CLIP-seq
MIRT1395140	hsa-miR-3065-3p	CLIP-seq
MIRT1395141	hsa-miR-3175	CLIP-seq
MIRT1395142	hsa-miR-4260	CLIP-seq
MIRT1395143	hsa-miR-4283	CLIP-seq
MIRT1395144	hsa-miR-4447	CLIP-seq
MIRT1395145	hsa-miR-4472	CLIP-seq
MIRT1395146	hsa-miR-4489	CLIP-seq
MIRT1395147	hsa-miR-4525	CLIP-seq
MIRT1395148	hsa-miR-4665-5p	CLIP-seq
MIRT1395149	hsa-miR-4715-3p	CLIP-seq
MIRT1395150	hsa-miR-4723-5p	CLIP-seq
MIRT1395151	hsa-miR-4728-5p	CLIP-seq
MIRT1395152	hsa-miR-4733-3p	CLIP-seq
MIRT1395153	hsa-miR-4745-3p	CLIP-seq
MIRT1395154	hsa-miR-4755-3p	CLIP-seq
MIRT1395155	hsa-miR-4783-3p	CLIP-seq
MIRT1395156	hsa-miR-625	CLIP-seq
MIRT1395157	hsa-miR-760	CLIP-seq
MIRT1395158	hsa-miR-764	CLIP-seq
MIRT1395139	hsa-miR-198	CLIP-seq
MIRT1395142	hsa-miR-4260	CLIP-seq
MIRT1395143	hsa-miR-4283	CLIP-seq
MIRT1395146	hsa-miR-4489	CLIP-seq
MIRT1395154	hsa-miR-4755-3p	CLIP-seq
MIRT1395157	hsa-miR-760	CLIP-seq
MIRT2340614	hsa-miR-106a	CLIP-seq
MIRT2340615	hsa-miR-106b	CLIP-seq
MIRT1395137	hsa-miR-1275	CLIP-seq
MIRT2340616	hsa-miR-1286	CLIP-seq
MIRT2340617	hsa-miR-17	CLIP-seq
MIRT2340618	hsa-miR-20a	CLIP-seq
MIRT2340619	hsa-miR-20b	CLIP-seq
MIRT1395141	hsa-miR-3175	CLIP-seq
MIRT1395144	hsa-miR-4447	CLIP-seq
MIRT1395145	hsa-miR-4472	CLIP-seq
MIRT1395147	hsa-miR-4525	CLIP-seq
MIRT1395148	hsa-miR-4665-5p	CLIP-seq
MIRT1395149	hsa-miR-4715-3p	CLIP-seq
MIRT2340620	hsa-miR-4722-5p	CLIP-seq
MIRT1395150	hsa-miR-4723-5p	CLIP-seq
MIRT1395151	hsa-miR-4728-5p	CLIP-seq
MIRT1395152	hsa-miR-4733-3p	CLIP-seq
MIRT2340621	hsa-miR-519a	CLIP-seq
MIRT2340622	hsa-miR-519b-3p	CLIP-seq
MIRT2340623	hsa-miR-519c-3p	CLIP-seq
MIRT2340624	hsa-miR-519d	CLIP-seq
MIRT1395156	hsa-miR-625	CLIP-seq
MIRT1395158	hsa-miR-764	CLIP-seq
MIRT2340625	hsa-miR-93	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23455924
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005902	Component	Microvillus	IBA
GO:0005929	Component	Cilium	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046581	Component	Intercellular canaliculus	IBA

MIM	HGNC	e!Ensembl
617382	10666	ENSG00000214530

Q9Y365

Protein name

START domain-containing protein 10 (StARD10) (Antigen NY-CO-28) (PCTP-like protein) (PCTP-L) (Serologically defined colon cancer antigen 28) (StAR-related lipid transfer protein 10)

Protein function

May play metabolic roles in sperm maturation or fertilization (By similarity). Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1

PDB

6SER

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01852	START	28 → 226	START domain	Domain

Sequence

MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVE
MDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWR
CPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKS
CVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPE
QSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT

Sequence length

291

Interactions

View interactions

	Reactome
			Synthesis of PC

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	19676041, 30611309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20543867, 36077333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33535042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28132686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19676041, 30611309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30611309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19676041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tremor	Tremor	Pubtator	34320404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

STARD10 (StAR related lipid transfer domain containing 10)